ORC5L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ORC5L Antibody [NBP1-82476] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: ORC5L Antibody [NBP1-82476] - Staining of human rectum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry: ORC5L Antibody [NBP1-82476] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ORC5L Antibody [NBP1-82476] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ORC5L Antibody [NBP1-82476] - Staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ORC5L Antibody [NBP1-82476] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORC5L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHVELPYYSKFILIAA
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ORC5L Protein (NBP1-82476PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ORC5L Antibody

  • ORC5Lorigin recognition complex, subunit 5-like (yeast)
  • ORC5P
  • ORC5T
  • origin recognition complex subunit 5
  • origin recognition complex, subunit 5 (yeast homolog)-like
  • origin recognition complex, subunit 5 homolog (yeast)
  • origin recognition complex, subunit 5
  • origin recognition complex, subunit 5-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-09473
Species: Hu
Applications: WB
H00004999-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-31132
Species: Hu
Applications: WB, ICC/IF
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00023594-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-15837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-796
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
DDX0010P-100
Species: Hu, Ca
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, Flow-CS
NB100-79778
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4479
Species: Hu
Applications: IHC
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92102
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33105
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA

Publications for ORC5L Antibody (NBP1-82476) (0)

There are no publications for ORC5L Antibody (NBP1-82476).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC5L Antibody (NBP1-82476) (0)

There are no reviews for ORC5L Antibody (NBP1-82476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ORC5L Antibody (NBP1-82476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ORC5L Products

Array NBP1-82476

Bioinformatics Tool for ORC5L Antibody (NBP1-82476)

Discover related pathways, diseases and genes to ORC5L Antibody (NBP1-82476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC5L Antibody (NBP1-82476)

Discover more about diseases related to ORC5L Antibody (NBP1-82476).
 

Pathways for ORC5L Antibody (NBP1-82476)

View related products by pathway.

PTMs for ORC5L Antibody (NBP1-82476)

Learn more about PTMs related to ORC5L Antibody (NBP1-82476).

Blogs on ORC5L

There are no specific blogs for ORC5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORC5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC5