ORC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ORC1 Antibody [NBP1-83184] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli, plasma membrane & cytosol.
Immunohistochemistry-Paraffin: ORC1 Antibody [NBP1-83184] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ORC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ORC1 Protein (NBP1-83184PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ORC1 Antibody

  • HS
  • HSORC1
  • ORC1Lorigin recognition complex subunit 1
  • origin recognition complex, subunit 1 (yeast homolog)-like
  • origin recognition complex, subunit 1 homolog (S. cerevisiae)
  • origin recognition complex, subunit 1 homolog
  • origin recognition complex, subunit 1
  • origin recognition complex, subunit 1-like (yeast)
  • origin recognition complex, subunit 1-like
  • PARC1origin recognition complex 1
  • Replication control protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-581
Species: Hu, Rt
Applications: WB, IP
NBP2-06099
Species: Hu
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP2-46403
Species: Hu
Applications: IHC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-798
Species: Hu, Mu
Applications: WB, PEP-ELISA
H00023594-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-249
Species: Hu
Applications: WB, IHC, PLA, ICC
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for ORC1 Antibody (NBP1-83184) (0)

There are no publications for ORC1 Antibody (NBP1-83184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC1 Antibody (NBP1-83184) (0)

There are no reviews for ORC1 Antibody (NBP1-83184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ORC1 Antibody (NBP1-83184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ORC1 Products

Bioinformatics Tool for ORC1 Antibody (NBP1-83184)

Discover related pathways, diseases and genes to ORC1 Antibody (NBP1-83184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC1 Antibody (NBP1-83184)

Discover more about diseases related to ORC1 Antibody (NBP1-83184).
 

Pathways for ORC1 Antibody (NBP1-83184)

View related products by pathway.

PTMs for ORC1 Antibody (NBP1-83184)

Learn more about PTMs related to ORC1 Antibody (NBP1-83184).
 

Research Areas for ORC1 Antibody (NBP1-83184)

Find related products by research area.

Blogs on ORC1

There are no specific blogs for ORC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ORC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC1
Entrez
Uniprot