ORC6L Antibody - BSA Free

Western Blot: ORC6L Antibody [NBP2-57470] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: ORC6L Antibody [NBP2-57470] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli fibrillar center.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ORC6L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ORC6L Antibody - BSA Free (NBP2-57470) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORC6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ORC6L Recombinant Protein Antigen (NBP2-57470PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ORC6L Antibody - BSA Free

• ORC6Lorigin recognition complex, subunit 6 homolog-like (yeast)
• origin recognition complex subunit 6
• origin recognition complex, subunit 6 like (yeast)
• origin recognition complex, subunit 6

Background

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ORC6