ORC6L Antibody


Western Blot: ORC6L Antibody [NBP2-57470] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ORC6L Antibody [NBP2-57470] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli fibrillar center.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

ORC6L Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQ
Specificity of human ORC6L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ORC6L Recombinant Protein Antigen (NBP2-57470PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ORC6L Antibody

  • ORC6Lorigin recognition complex, subunit 6 homolog-like (yeast)
  • origin recognition complex subunit 6
  • origin recognition complex, subunit 6 like (yeast)
  • origin recognition complex, subunit 6


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ORC6L Antibody (NBP2-57470) (0)

There are no publications for ORC6L Antibody (NBP2-57470).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC6L Antibody (NBP2-57470) (0)

There are no reviews for ORC6L Antibody (NBP2-57470). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ORC6L Antibody (NBP2-57470) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ORC6L Antibody (NBP2-57470)

Discover related pathways, diseases and genes to ORC6L Antibody (NBP2-57470). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ORC6L Antibody (NBP2-57470)

Discover more about diseases related to ORC6L Antibody (NBP2-57470).

Pathways for ORC6L Antibody (NBP2-57470)

View related products by pathway.

PTMs for ORC6L Antibody (NBP2-57470)

Learn more about PTMs related to ORC6L Antibody (NBP2-57470).

Blogs on ORC6L

There are no specific blogs for ORC6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ORC6L Antibody and receive a gift card or discount.


Gene Symbol ORC6