SLURP1 Antibody (4D1) - Azide and BSA Free

Western Blot: SLURP1 Antibody (4D1) [H00057152-M06] - Analysis of SLURP1 expression in transfected 293T cell line by SLURP1 monoclonal antibody (M06), clone 4D1. Lane 1: SLURP1 transfected lysatE (11.2 KDa). Lane 2: Non-transfected lysate.

ELISA: SLURP1 Antibody (4D1) [H00057152-M06] - Detection limit for recombinant GST tagged SLURP1 is approximately 0.1ng/ml as a capture antibody.

Immunoprecipitation: SLURP1 Antibody (4D1) [H00057152-M06] - Analysis of SLURP1 transfected lysate using anti-SLURP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SLURP1 rabbit polyclonal antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC, IP
• Clone: 4D1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLURP1 Antibody (4D1) - Azide and BSA Free Summary

• Immunogen: SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
• Specificity: SLURP1 - secreted LY6/PLAUR domain containing 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLURP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunohistochemistry-Frozen
  • Immunoprecipitation 1:10-1:1000
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLURP1 Antibody (4D1) - Azide and BSA Free

• ANUPARS(component B)-81/S
• ARS Component B
• ArsB
• ARSlymphocyte antigen 6-like secreted
• LY6LS
• MDMsecreted Ly-6/uPAR-related protein 1
• neoplastic urinary protein
• secreted LY6/PLAUR domain containing 1
• secreted Ly6/uPAR related protein 1
• SLURP1
• SLURP-1

Background

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLURP1 Antibody (H00057152-M06)(2)

Publications using H00057152-M06

• Meric P, Buduneli N, Kanmaz B et al. Cholinergic Signaling Mechanisms and Early Implant Healing Phases in Healthy Versus Generalized Aggressive Periodontitis Patients: A prospective, case-control study. J Clin Periodontol. 2019-09-09 [PMID: 31444906]
• Narumoto O, Horiguchi K, Horiguchi S et al. Down-regulation of secreted lymphocyte antigen-6/urokinase-type plasminogen activator receptor-related peptide-1 (SLURP-1), an endogenous allosteric alpha7 nicotinic acetylcholine receptor modulator, in murine and human asthmatic conditions. Biochem Biophys Res Commun. 2010-07-15 [PMID: 20621062]

Bioinformatics

• Gene Symbol: SLURP1
• Entrez:
  • 57152(Human)
• OMIM:
  • 248300(Human)
• Uniprot:
  • NP_065160(Human)