ORC4L Antibody - BSA Free

Western Blot: ORC4L Antibody [NBP2-56938] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: ORC4L Antibody [NBP2-56938] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ORC4L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ORC4L Antibody - BSA Free (NBP2-56938) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ORC4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ORC4L Recombinant Protein Antigen (NBP2-56938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ORC4L Antibody - BSA Free

• HsORC4
• ORC4LFLJ46668
• ORC4P
• origin recognition complex subunit 4
• origin recognition complex, subunit 4 (yeast homolog)-like
• origin recognition complex, subunit 4 homolog (S. cerevisiae)
• origin recognition complex, subunit 4 homolog
• origin recognition complex, subunit 4
• origin recognition complex, subunit 4-like (S. cerevisiae)
• origin recognition complex, subunit 4-like (yeast)
• origin recognition complex, subunit 4-like

Background

The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. It has been shown to form a core complex with ORC2L, -3L, and -5L. Three alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ORC4