Orai2 Antibody


Immunocytochemistry/ Immunofluorescence: Orai2 Antibody [NBP2-55443] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

Orai2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW
Specificity of human Orai2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Orai2 Recombinant Protein Antigen (NBP2-55443PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Orai2 Antibody

  • CAP-binding protein complex interacting protein 2
  • CAP-binding protein complex-interacting protein 2
  • CBCIP2C7orf19FLJ12474
  • chromosome 7 open reading frame 19
  • FLJ14733
  • H_NH0514P08.8
  • MEM142B
  • ORAI calcium release-activated calcium modulator 2
  • protein orai-2
  • putative protein ORAI2-2
  • TMEM142B
  • Transmembrane protein 142BFLJ44818


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF

Publications for Orai2 Antibody (NBP2-55443) (0)

There are no publications for Orai2 Antibody (NBP2-55443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orai2 Antibody (NBP2-55443) (0)

There are no reviews for Orai2 Antibody (NBP2-55443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Orai2 Antibody (NBP2-55443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Orai2 Antibody (NBP2-55443)

Discover related pathways, diseases and genes to Orai2 Antibody (NBP2-55443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orai2 Antibody (NBP2-55443)

Discover more about diseases related to Orai2 Antibody (NBP2-55443).

Pathways for Orai2 Antibody (NBP2-55443)

View related products by pathway.

PTMs for Orai2 Antibody (NBP2-55443)

Learn more about PTMs related to Orai2 Antibody (NBP2-55443).

Blogs on Orai2

There are no specific blogs for Orai2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Orai2 Antibody and receive a gift card or discount.


Gene Symbol ORAI2