KCNN4 Antibody


Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human colon shows strong cytoplasmic/ membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human prostate shows strong cytoplasmic/ membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KCNN4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
Specificity of human KCNN4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC, ICC/IF reactivity reported in (PMID: 25848765).
Control Peptide
KCNN4 Protein (NBP2-33694PEP)
Read Publication using NBP2-33694.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 25848765)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KCNN4 Antibody

  • hIKCa1
  • hKCa4
  • hSK4
  • IK1
  • IKCa1
  • intermediate conductance calcium-activated potassium channel protein 4
  • KCa3.1IKCA1
  • KCa4
  • KCA4SKCa4
  • potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4
  • putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel
  • Putative Gardos channel
  • SK4SKCa 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb, Re, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-reported, Dual ISH-IHC, Flow-IC, Single-Cell Western
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KCNN4 Antibody (NBP2-33694)(1)

We have publications tested in 2 applications: ICC/IF, IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for KCNN4 Antibody (NBP2-33694) (0)

There are no reviews for KCNN4 Antibody (NBP2-33694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNN4 Antibody (NBP2-33694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional KCNN4 Products

Bioinformatics Tool for KCNN4 Antibody (NBP2-33694)

Discover related pathways, diseases and genes to KCNN4 Antibody (NBP2-33694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNN4 Antibody (NBP2-33694)

Discover more about diseases related to KCNN4 Antibody (NBP2-33694).

Pathways for KCNN4 Antibody (NBP2-33694)

View related products by pathway.

PTMs for KCNN4 Antibody (NBP2-33694)

Learn more about PTMs related to KCNN4 Antibody (NBP2-33694).

Blogs on KCNN4

There are no specific blogs for KCNN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCNN4 Antibody and receive a gift card or discount.


Gene Symbol KCNN4