Novus Biologicals products are now on bio-techne.com

KCNN4 Antibody

Images

 
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human colon shows strong cytoplasmic/ membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human prostate shows strong cytoplasmic/ membranous positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: KCNN4 Antibody [NBP2-33694] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNN4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC, ICC/IF reactivity reported in (PMID: 25848765).
Control Peptide
KCNN4 Protein (NBP2-33694PEP)
Publications
Read Publication using NBP2-33694.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%). Reactivity reported in scientific literature (PMID: 25848765)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNN4 Antibody

  • hIKCa1
  • hKCa4
  • hSK4
  • IK1
  • IKCa1
  • intermediate conductance calcium-activated potassium channel protein 4
  • KCa3.1
  • KCa3.1IKCA1
  • KCa4
  • KCA4SKCa4
  • KCNN4
  • potassium intermediate/small conductance calcium-activated channel, subfamilyN, member 4
  • putative erythrocyte intermediate conductance calcium-activated potassiumGardos channel
  • Putative Gardos channel
  • SK4
  • SK4SKCa 4
  • SKCa 4
  • SKCa4

Background

KCNN4 (Kca3.1) is part of a potentially heterotetrameric voltage independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. KCNN4 may be part of the predominant calcium activated potassium channel in T lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20119
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-85137
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP2-48533
Species: Hu
Applications: IHC, IHC-P
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP2-87781
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-84112
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NBP3-04811
Species: Hu, Mu
Applications: WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP3-10293
Species: Hu
Applications: WB
NBP1-55135
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC

Publications for KCNN4 Antibody (NBP2-33694)(1)

We have publications tested in 2 applications: ICC/IF, IF/IHC.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
All Applications
Filter By Species
All Species

Reviews for KCNN4 Antibody (NBP2-33694) (0)

There are no reviews for KCNN4 Antibody (NBP2-33694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNN4 Antibody (NBP2-33694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNN4 Products

Research Areas for KCNN4 Antibody (NBP2-33694)

Find related products by research area.

Blogs on KCNN4

There are no specific blogs for KCNN4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNN4
Uniprot