Reactivity | HuSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | KCNN4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC, ICC/IF reactivity reported in (PMID: 25848765). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-33694 | Applications | Species |
---|---|---|
Rabjerg M, Olivan-Viguera A, Hansen LK et al. High Expression of KCa3.1 in Patients with Clear Cell Renal Carcinoma Predicts High Metastatic Risk and Poor Survival. PLoS One 2015-01-01 [PMID: 25848765] (ICC/IF, IF/IHC) | ICC/IF, IF/IHC |
Secondary Antibodies |
Isotype Controls |
Diseases for KCNN4 Antibody (NBP2-33694)Discover more about diseases related to KCNN4 Antibody (NBP2-33694).
| Pathways for KCNN4 Antibody (NBP2-33694)View related products by pathway.
|
PTMs for KCNN4 Antibody (NBP2-33694)Learn more about PTMs related to KCNN4 Antibody (NBP2-33694).
| Research Areas for KCNN4 Antibody (NBP2-33694)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.