Olig2 Antibody

Images

 
Western Blot: Olig2 Antibody [NBP1-88634] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: Olig2 Antibody [NBP1-88634] - Immunohistochemical staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: Olig2 Antibody [NBP1-88634] - Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in oligodendrocytes.
Immunohistochemistry-Paraffin: Olig2 Antibody [NBP1-88634] - Immunohistochemical staining of human glioma shows moderate nuclear positivity in tumor cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Olig2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
Marker
Oligodendrocyte Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLIG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Olig2 Protein (NBP1-88634PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Olig2 Antibody

  • BHLHB1
  • BHLHE19
  • Class B basic helix-loop-helix protein 1
  • Class E basic helix-loop-helix protein 19
  • human protein kinase C-binding protein RACK17
  • Olig2
  • OLIGO2
  • oligodendrocyte lineage transcription factor 2
  • oligodendrocyte transcription factor 2
  • oligodendrocyte-specific bHLH transcription factor 2
  • PRKCBP2
  • protein kinase C binding protein 2
  • Protein kinase C-binding protein 2
  • Protein kinase C-binding protein RACK17
  • RACK17
  • RACK17helix-loop-helix protein, class B, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2417
Species: Hu, Mu
Applications: WB, IHC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
AF2567
Species: Mu
Applications: WB, IHC
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57712
Species: Hu
Applications: ICC/IF
AF2864
Species: Hu
Applications: WB, ICC
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88634
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Olig2 Antibody (NBP1-88634) (0)

There are no publications for Olig2 Antibody (NBP1-88634).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Olig2 Antibody (NBP1-88634) (0)

There are no reviews for Olig2 Antibody (NBP1-88634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Olig2 Antibody (NBP1-88634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Olig2 Products

Bioinformatics Tool for Olig2 Antibody (NBP1-88634)

Discover related pathways, diseases and genes to Olig2 Antibody (NBP1-88634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Olig2 Antibody (NBP1-88634)

Discover more about diseases related to Olig2 Antibody (NBP1-88634).
 

Pathways for Olig2 Antibody (NBP1-88634)

View related products by pathway.

PTMs for Olig2 Antibody (NBP1-88634)

Learn more about PTMs related to Olig2 Antibody (NBP1-88634).

Blogs on Olig2

There are no specific blogs for Olig2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Olig2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLIG2
Entrez
Uniprot