Olig2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI |
| Marker |
Oligodendrocyte Marker |
| Predicted Species |
Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OLIG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Olig2 Antibody - BSA Free
Background
Olig2 is a transcription factor which is required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. OIlig2 is expressed in the ventral spinal cord as early as 9.5 dpc and is scattered in the mantle zone, likely corresponding to oligodendrocyte progenitors migrating out from their site of origin. (Arnett et al., 2004) From 10.5 through 14.5 dpc, Olig2 is expressed in numerous cells in the ventricular and subventricular zones of the lateral and medial ganglionic eminences, suggesting that expression might not be limited to the oligodendrocytic lineage. Olig2 has further been shown to be critical in the proliferation of malignant glioma in brain tumors (Ligon et al., 2007).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: BA
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Mu
Applications: IHC, WB
Species: Fe, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC, ChIP
Publications for Olig2 Antibody (NBP1-88634) (0)
There are no publications for Olig2 Antibody (NBP1-88634).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Olig2 Antibody (NBP1-88634) (0)
There are no reviews for Olig2 Antibody (NBP1-88634).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Olig2 Antibody (NBP1-88634) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Olig2 Products
Research Areas for Olig2 Antibody (NBP1-88634)
Find related products by research area.
|
Blogs on Olig2