OCC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OCC1 Antibody [NBP2-38063] - Immunofluorescent staining of human cell line CACO-2 shows localization to vesicles.
Immunohistochemistry-Paraffin: OCC1 Antibody [NBP2-38063] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OCC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12orf75
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
OCC1 Protein (NBP2-38063PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OCC1 Antibody

  • Adipogenesis Down-Regulated 3
  • AGD3
  • C12orf75
  • Chromosome 12 Open Reading Frame 75
  • OCC1
  • OCC-1
  • Overexpressed In Colon Carcinoma 1 Protein
  • Overexpressed In Colon Carcinoma 1
  • Overexpressed In Colon Carcinoma-1
  • Putative Overexpressed In Colon Carcinoma-1 Protein Variant C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59322
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94657
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2328
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-27406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001806-M01
Species: Hu
Applications: WB, DB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF5956
Species: Hu, Mu
Applications: WB
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
MAB2327
Species: Hu
Applications: WB, IP

Publications for OCC1 Antibody (NBP2-38063) (0)

There are no publications for OCC1 Antibody (NBP2-38063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCC1 Antibody (NBP2-38063) (0)

There are no reviews for OCC1 Antibody (NBP2-38063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OCC1 Antibody (NBP2-38063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OCC1 Products

Array NBP2-38063

Bioinformatics Tool for OCC1 Antibody (NBP2-38063)

Discover related pathways, diseases and genes to OCC1 Antibody (NBP2-38063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on OCC1

There are no specific blogs for OCC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12orf75
Uniprot