HMGA1 Antibody (5J0E6)

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379] - Western blot analysis of extracts of various cell lines, using HMGA1 Rabbit mAb (NBP3-16379) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of HMGA1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of HMGA1 across chromosome 12(upper panel) and the genomic region encompassing HNF1A, a representative gene enriched in HMGA1 (lower panel).

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: HMGA1 Antibody (5J0E6) [NBP3-16379] - Western blot analysis of lysates from Mouse testis, using HMGA1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of HMGA1 Rabbit mAb . DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of HMGA1 in the representative genomic region surrounding HNF1A gene.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Chromatin Immunoprecipitation: HMGA1 Antibody (5J0E6) [NBP3-16379] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using HMGA1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: HMGA1 Antibody (5J0E6) [NBP3-16379] - Confocal imaging of U-2 OS cells using HMGA1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: HMGA1 Antibody (5J0E6) [NBP3-16379] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using HMGA1 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, ChIP
• Clone: 5J0E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HMGA1 Antibody (5J0E6) Summary

• Description: Novus Biologicals Rabbit HMGA1 Antibody (5J0E6) (NBP3-16379) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-107 of human HMGA1 (P17096). MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HMGA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 3ug antibody for 10ug-15ug of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:1000
  • Immunohistochemistry 1:2000 - 1:8000
  • Immunohistochemistry-Paraffin 1:2000 - 1:8000
  • Western Blot 1:1000 - 1:4000
• Theoretical MW: 12 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMGA1 Antibody (5J0E6)

• high mobility group AT-hook 1
• High mobility group AT-hook protein 1
• High mobility group protein A1
• high mobility group protein HMG-I/HMG-Y
• High mobility group protein R
• high-mobility group (nonhistone chromosomal) protein isoforms I and Y
• HMGA1A
• HMG-I(Y)
• HMGIYMGC12816
• HMG-R
• MGC4242
• MGC4854
• nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y

Background

HMGA1 is expected to recognise isoform a (also called HMG-I; NP_665906.1; NP_665908.1; NP_665911.1) and isoform b (also called HMG-Y; NP_002122.1; NP_665909.1; NP_665910.1; NP_665912.1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGA1