NTNG1 Antibody


Immunocytochemistry/ Immunofluorescence: NTNG1 Antibody [NBP2-57380] - Staining of human cell line BJ shows localization to plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NTNG1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGD
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NTNG1 Recombinant Protein Antigen (NBP2-57380PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NTNG1 Antibody

  • axon guidance molecule
  • KIAA0976YLSR571
  • laminet 1
  • laminet-1
  • Lmnt1
  • netrin G1
  • netrin G1f
  • netrin-G1


Netrin G1 (NTNG1) belongs to a conserved family of proteins that act as axon guidance cues during vertebrate nervous system development (Nakashiba et al., 2000 [PubMed 10964959]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NTNG1 Antibody (NBP2-57380) (0)

There are no publications for NTNG1 Antibody (NBP2-57380).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTNG1 Antibody (NBP2-57380) (0)

There are no reviews for NTNG1 Antibody (NBP2-57380). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NTNG1 Antibody (NBP2-57380) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NTNG1 Products

Research Areas for NTNG1 Antibody (NBP2-57380)

Find related products by research area.

Blogs on NTNG1

There are no specific blogs for NTNG1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NTNG1 Antibody and receive a gift card or discount.


Gene Symbol NTNG1