NTB-A/SLAMF6/CD352 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLAMF6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NTB-A/SLAMF6/CD352 Antibody - BSA Free
Background
NTBA (NK-, T-, and B-cell Antigen) is a 60 kD type I transmembrane glycoprotein. It is a member of Ig superfamily belonging to CD2/CD150 subfamily, also known as SLAMF6 (SLAM family member 6), LY108, TCOM, or SF2000. This antigen is expressed on NK cells, T cells (upregulated upon activation), and B cells. NTBA is its own ligand. The homophilic interaction of NTBA is involved in the induction of NK cytotoxicity, CD28 independent T cell costimulation, triggering Th1 cytokines production, and regulation of B cell tolerance. It may play a role in the regulation of autoimmune diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Mu
Applications: BA
Species: Hu
Applications: IHC
Publications for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002) (0)
There are no publications for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002) (0)
There are no reviews for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NTB-A/SLAMF6/CD352 Products
Research Areas for NTB-A/SLAMF6/CD352 Antibody (NBP2-49002)
Find related products by research area.
|
Blogs on NTB-A/SLAMF6/CD352