NTB-A/SLAMF6/CD352 Antibody

Images

 
Western Blot: NTB-A/SLAMF6/CD352 Antibody [NBP1-69377] - This Anti-NTB-A/SLAMF6/CD352 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NTB-A/SLAMF6/CD352 Antibody Summary

Immunogen
Synthetic peptides corresponding to LY108 The peptide sequence was selected from the N terminal of LY108. Peptide sequence EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLAMF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLAMF6 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NTB-A/SLAMF6/CD352 Antibody

  • Activating NK receptor
  • CD352 antigen
  • CD352
  • KALIFLJ50657
  • Ly108
  • NK-T-B-antigen
  • NTBA receptor
  • NTBA
  • NTB-A
  • NTB-AMGC104953
  • NTBAT- and B-cell antigen
  • SF2000
  • SLAM family member 6
  • SLAMF6

Background

LY108 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. LY108 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. The protein encoded by this gene is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. This encoded protein is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
MAB2555
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-45868
Species: Hu
Applications: WB, IHC, IHC-P
AF3327
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF1039
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
MAB1855
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
1849-NK
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB689
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
NBP1-69377
Species: Hu
Applications: WB

Publications for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377) (0)

There are no publications for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377) (0)

There are no reviews for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NTB-A/SLAMF6/CD352 Products

Bioinformatics Tool for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377)

Discover related pathways, diseases and genes to NTB-A/SLAMF6/CD352 Antibody (NBP1-69377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377)

Discover more about diseases related to NTB-A/SLAMF6/CD352 Antibody (NBP1-69377).
 

Pathways for NTB-A/SLAMF6/CD352 Antibody (NBP1-69377)

View related products by pathway.

Blogs on NTB-A/SLAMF6/CD352

There are no specific blogs for NTB-A/SLAMF6/CD352, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NTB-A/SLAMF6/CD352 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLAMF6
Entrez
Uniprot