NRARP Antibody

Images

 
Western Blot: NRARP Antibody [NBP1-82665] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: NRARP Antibody [NBP1-82665] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: NRARP Antibody [NBP1-82665] - Staining of human rectum shows moderate cytoplasmic positivity in subsets of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRARP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NRARP Protein (NBP1-82665PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRARP Antibody

  • MGC61598
  • NOTCH-regulated ankyrin repeat protein
  • notch-regulated ankyrin repeat-containing protein
  • NRARP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF4079
Species: Hu
Applications: WB, ICC
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1389
Species: Mu
Applications: WB, ICC
AF6915
Species: Hu, Mu, Rt
Applications: WB
H00004854-M01
Species: Hu
Applications: WB, ELISA
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-91669
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NRARP Antibody (NBP1-82665) (0)

There are no publications for NRARP Antibody (NBP1-82665).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRARP Antibody (NBP1-82665) (0)

There are no reviews for NRARP Antibody (NBP1-82665). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRARP Antibody (NBP1-82665) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRARP Products

Bioinformatics Tool for NRARP Antibody (NBP1-82665)

Discover related pathways, diseases and genes to NRARP Antibody (NBP1-82665). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRARP Antibody (NBP1-82665)

Discover more about diseases related to NRARP Antibody (NBP1-82665).
 

Pathways for NRARP Antibody (NBP1-82665)

View related products by pathway.

PTMs for NRARP Antibody (NBP1-82665)

Learn more about PTMs related to NRARP Antibody (NBP1-82665).

Blogs on NRARP

There are no specific blogs for NRARP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRARP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRARP
Entrez