NRARP Antibody

Images

 
Western Blot: NRARP Antibody [NBP1-56421] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRARP Antibody Summary

Immunogen
Synthetic peptides corresponding to NRARP(Notch-regulated ankyrin repeat protein) The peptide sequence was selected from the middle region of NRARP (NP_001004354). Peptide sequence QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Zebrafish (100%), Canine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRARP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NRARP and was validated on Western blot.
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-56421.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NRARP Antibody

  • MGC61598
  • NOTCH-regulated ankyrin repeat protein
  • notch-regulated ankyrin repeat-containing protein
  • NRARP

Background

NRARP may play a role in the formation of somites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
AF1389
Species: Mu
Applications: WB, IHC, ICC
AF6915
Species: Hu, Mu, Rt
Applications: WB
H00004854-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-91670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56421
Species: Hu, Mu, Rt, Po, Bv, Ca, Ze
Applications: WB

Publications for NRARP Antibody (NBP1-56421)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-56421 Applications Species
Strausberg,RL. Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903. 2002 [PMID: 12477932]

Reviews for NRARP Antibody (NBP1-56421) (0)

There are no reviews for NRARP Antibody (NBP1-56421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRARP Antibody (NBP1-56421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRARP Products

Bioinformatics Tool for NRARP Antibody (NBP1-56421)

Discover related pathways, diseases and genes to NRARP Antibody (NBP1-56421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRARP Antibody (NBP1-56421)

Discover more about diseases related to NRARP Antibody (NBP1-56421).
 

Pathways for NRARP Antibody (NBP1-56421)

View related products by pathway.

PTMs for NRARP Antibody (NBP1-56421)

Learn more about PTMs related to NRARP Antibody (NBP1-56421).

Blogs on NRARP

There are no specific blogs for NRARP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRARP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRARP
Entrez
Uniprot