Nocturnin Antibody


Immunohistochemistry-Paraffin: Nocturnin Antibody [NBP2-87931] - Rabbit Anti-CCRN4L antibody. Paraffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubule. Antibody Concentration: more
Immunohistochemistry: Nocturnin Antibody [NBP2-87931] - Human Lung

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Nocturnin Antibody Summary

The immunogen is a synthetic peptide directed towards the N terminal region of human Nocturnin. Peptide sequence: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for Nocturnin Antibody

  • CCR4 carbon catabolite repression 4-like (S. cerevisiae)
  • CCR4 protein homolog
  • CCR4-like (carbon catabolite repression 4, S.cerevisiae)
  • CCR4LMGC142060
  • CCR4MGC4120817
  • MGC142054
  • MGC78549
  • NOC
  • nocturnin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-reported, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Neut

Publications for Nocturnin Antibody (NBP2-87931) (0)

There are no publications for Nocturnin Antibody (NBP2-87931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nocturnin Antibody (NBP2-87931) (0)

There are no reviews for Nocturnin Antibody (NBP2-87931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nocturnin Antibody (NBP2-87931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Nocturnin Products

Bioinformatics Tool for Nocturnin Antibody (NBP2-87931)

Discover related pathways, diseases and genes to Nocturnin Antibody (NBP2-87931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nocturnin Antibody (NBP2-87931)

Discover more about diseases related to Nocturnin Antibody (NBP2-87931).

Pathways for Nocturnin Antibody (NBP2-87931)

View related products by pathway.

Blogs on Nocturnin

There are no specific blogs for Nocturnin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nocturnin Antibody and receive a gift card or discount.


Gene Symbol CCRN4L