NLRP10/Pynod/NALP10 Antibody

Images

 
Immunohistochemistry-Paraffin: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLRP10/Pynod/NALP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLRP10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC-P reported in scientific literature (PMID: 26976200). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NLRP10/Pynod/NALP10 Protein (NBP1-85556PEP)
Publications
Read Publication using
NBP1-85556 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLRP10/Pynod/NALP10 Antibody

  • CLR11.1
  • NACHT, leucine rich repeat and PYD containing 10
  • NALP10
  • NALP10Pynod
  • NLR family, pyrin domain containing 10
  • NLRP10
  • NOD8
  • NOD8Nucleotide-binding oligomerization domain protein 8
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 10
  • PAN5
  • Pynod
  • PYNODNACHT, LRR and PYD domains-containing protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB868
Species: Hu
Applications: WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56155
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NB100-56637
Species: Hu, Mu
Applications: WB
NBP1-76293
Species: Hu, Mu, Rt, V-Vi
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF2880
Species: Hu, Mu
Applications: WB
NBP3-12306
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB

Publications for NLRP10/Pynod/NALP10 Antibody (NBP1-85556)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NLRP10/Pynod/NALP10 Antibody (NBP1-85556) (0)

There are no reviews for NLRP10/Pynod/NALP10 Antibody (NBP1-85556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NLRP10/Pynod/NALP10 Antibody (NBP1-85556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLRP10/Pynod/NALP10 Products

Bioinformatics Tool for NLRP10/Pynod/NALP10 Antibody (NBP1-85556)

Discover related pathways, diseases and genes to NLRP10/Pynod/NALP10 Antibody (NBP1-85556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRP10/Pynod/NALP10 Antibody (NBP1-85556)

Discover more about diseases related to NLRP10/Pynod/NALP10 Antibody (NBP1-85556).
 

Pathways for NLRP10/Pynod/NALP10 Antibody (NBP1-85556)

View related products by pathway.

Blogs on NLRP10/Pynod/NALP10

There are no specific blogs for NLRP10/Pynod/NALP10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLRP10/Pynod/NALP10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP10