NLRP10/Pynod/NALP10 Antibody - BSA Free

Immunohistochemistry-Paraffin: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NLRP10/Pynod/NALP10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NLRP10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-P reported in scientific literature (PMID: 26976200). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NLRP10/Pynod/NALP10 Protein (NBP1-85556PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NLRP10/Pynod/NALP10 Antibody - BSA Free

• CLR11.1
• NACHT, leucine rich repeat and PYD containing 10
• NALP10
• NALP10Pynod
• NLR family, pyrin domain containing 10
• NLRP10
• NOD8
• NOD8Nucleotide-binding oligomerization domain protein 8
• nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 10
• PAN5
• Pynod
• PYNODNACHT, LRR and PYD domains-containing protein 10

Background

Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminalleucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). The protein encoded by this gene belongs tothe NALP protein family despite lacking the LRR region. This protein likely plays a regulatory role in the innateimmune system. The protein belongs to the signal-induced multiprotein complex, the inflammasome, that activates thepro-inflammatory caspases, caspase-1 and caspase-5. Other experiments indicate that this gene acts as amultifunctional negative regulator of inflammation and apoptosis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NLRP10/Pynod/NALP10 Antibody (NBP1-85556)(1)

Publication using NBP1-85556

• Tervaniemi MH, Katayama S, Skoog T et al. NOD-like receptor signaling and inflammasome-related pathways are highlighted in psoriatic epidermis. Sci Rep. 2016-03-15 [PMID: 26976200] (IHC-P, Human)
  
  Details:
  HDAC1 antibody was used for WB analysis of abdominal aorta samples from control subjects and the patients undergoing abdominal aortic aneurysms /AAA.

Bioinformatics

• Gene Symbol: NLRP10