NLRC5 Antibody


Immunocytochemistry/ Immunofluorescence: NLRC5 Antibody [NBP2-57028] - Staining of human cell line U-2 OS shows localization to centrosome. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NLRC5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QHLRVLHLPFSHLGPGGALSLAQALDGSPHLEEISLAENNLAGGVLRFCMELPLLRQIDLVSCKIDNQTAKLLTSSFTSCPALEVILLSWNLLGDE
Specificity of human NLRC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NLRC5 Recombinant Protein Antigen (NBP2-57028PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NLRC5 Antibody

  • Caterpiller Protein 16.1
  • CLR16.1
  • NLR Family CARD Domain Containing 5
  • NOD27
  • NOD4
  • NOD-Like Receptor C5
  • Nucleotide-Binding Oligomerization Domain Protein 27
  • Nucleotide-Binding Oligomerization Domain Protein 4
  • Nucleotide-Binding Oligomerization Domains 27
  • Protein NLRC5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IM, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for NLRC5 Antibody (NBP2-57028) (0)

There are no publications for NLRC5 Antibody (NBP2-57028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRC5 Antibody (NBP2-57028) (0)

There are no reviews for NLRC5 Antibody (NBP2-57028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NLRC5 Antibody (NBP2-57028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NLRC5 Products

Array NBP2-57028

Bioinformatics Tool for NLRC5 Antibody (NBP2-57028)

Discover related pathways, diseases and genes to NLRC5 Antibody (NBP2-57028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLRC5 Antibody (NBP2-57028)

Discover more about diseases related to NLRC5 Antibody (NBP2-57028).

Pathways for NLRC5 Antibody (NBP2-57028)

View related products by pathway.

PTMs for NLRC5 Antibody (NBP2-57028)

Learn more about PTMs related to NLRC5 Antibody (NBP2-57028).

Blogs on NLRC5

There are no specific blogs for NLRC5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NLRC5 Antibody and receive a gift card or discount.


Gene Symbol NLRC5