TAP1 Antibody (3D4)

Images

 
Immunocytochemistry/ Immunofluorescence: TAP1 Antibody (3D4) [H00006890-M04] - Analysis of monoclonal antibody to TAP1 on HeLa cell. Antibody concentration 10 ug/ml
Flow Cytometry: TAP1 Antibody (3D4) [H00006890-M04] - Intracellular flow cytometric analysis of TAP1 antibody H00006890-M04 (orange filled) on interferon gamma treated HCT116 cells. Red dotted line in histogram ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF
Clone
3D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAP1 Antibody (3D4) Summary

Immunogen
TAP1 (AAH14081, 241 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
Specificity
TAP1 - transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) (3D4)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Flow Cytometry
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. This TAP1 Antibody (3D4) is validated for Flow Cytometry from a verified customer review.
Reviewed Applications
Read 1 Review rated 4
using
H00006890-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TAP1 Antibody (3D4)

  • ABC Transporter, MHC 1
  • ABC17
  • ABCB2
  • ABCB2FLJ41500
  • antigen peptide transporter 1
  • APT1
  • ATP-binding cassette sub-family B member 2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 2
  • D6S114E
  • Ham1
  • Peptide supply factor 1
  • Peptide transporter involved in antigen processing 1
  • Peptide transporter PSF1
  • Peptide Transporter TAP1
  • PSF1
  • PSF-1
  • PSF1ABC17
  • Really interesting new gene 4 protein
  • RING4
  • RING4FLJ26666
  • TAP1
  • TAP1*0102N
  • TAP1N
  • transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
  • transporter associated with antigen processing
  • transporter, ATP-binding cassette, major histocompatibility complex, 1
  • Y3

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP1-59071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
H00009260-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006890-M04
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for TAP1 Antibody (H00006890-M04) (0)

There are no publications for TAP1 Antibody (H00006890-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TAP1 Antibody (H00006890-M04) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00006890-M04:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry TAP1 H00006890-M04
Enlarge
4
reviewed by:
Anonymous
Flow Human 01/30/2020
View

Summary

ApplicationFlow Cytometry
Sample TestedHCT116 cells
SpeciesHuman
Lot08109-3D4

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAP1 Antibody (H00006890-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAP1 Products

Array H00006890-M04

Bioinformatics Tool for TAP1 Antibody (H00006890-M04)

Discover related pathways, diseases and genes to TAP1 Antibody (H00006890-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAP1 Antibody (H00006890-M04)

Discover more about diseases related to TAP1 Antibody (H00006890-M04).
 

Pathways for TAP1 Antibody (H00006890-M04)

View related products by pathway.

PTMs for TAP1 Antibody (H00006890-M04)

Learn more about PTMs related to TAP1 Antibody (H00006890-M04).
 

Research Areas for TAP1 Antibody (H00006890-M04)

Find related products by research area.

Blogs on TAP1

There are no specific blogs for TAP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
01/30/2020
Application: Flow
Species: Human

Bioinformatics

Gene Symbol TAP1
Entrez
Uniprot