NLE1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NLE1 Antibody [NBP1-83860] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.

Immunohistochemistry-Paraffin: NLE1 Antibody [NBP1-83860] -Staining of human fallopian tube shows moderate nucleoli positivity in glandular cells.

Immunohistochemistry-Paraffin: NLE1 Antibody [NBP1-83860] -Staining of human cerebral cortex shows moderate nucleoli positivity in neurons.

Immunohistochemistry-Paraffin: NLE1 Antibody [NBP1-83860] -Staining of human testis shows moderate nucleoli and nuclear positivity in subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NLE1 Antibody [NBP1-83860] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Analysis in human cell line A-431.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NLE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NLE1 Antibody - BSA Free (NBP1-83860) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NLE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NLE1 Recombinant Protein Antigen (NBP1-83860PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NLE1 Antibody - BSA Free

• FLJ10458
• Nle
• Notchless gene homolog
• notchless homolog 1 (Drosophila)
• notchless protein homolog 1

Background

The Notch signaling pathway is an evolutionary conserved system that is involved in intracellular communication. Notch receptors play an important role in development and cell-fate decisions. Notchless is a loss-of-function mutant allele that encodes for protein NLE1 (notchless homolog 1). NLE1 is a 485 amino acid WD40-repeat protein that binds to the cytoplasmic domain of Notch, regulating its signaling activity in Drosophila melanogaster and in mice. Deletion of the NLE1 gene in mice during the early stages of development results in embryonic death, while gene deletion in the late stages of development leads to activation of a caspase-3-dependent apoptotic pathway.In plants, NLE1 is crucial for normal cellular growth and development. Underexpression during shoot proliferation causes pleiotropic defects such as delayed flowering and abnormal organ maturation. It may also play a role in 60S ribosomal subunit biogenesis in yeast. NLE1 contains eight WD40 domains and produces one isoform due to alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NLE1