Cholecystokinin Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Analysis in human duodenum and skeletal muscle tissues using Anti-CCK antibody. Corresponding CCK RNA-seq data are more
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human hypothalamus shows strong positivity in neuronal projections.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Cholecystokinin Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for Cholecystokinin Antibody

  • CCK
  • cholecystokinin
  • MGC117187


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P

Publications for Cholecystokinin Antibody (NBP2-62664) (0)

There are no publications for Cholecystokinin Antibody (NBP2-62664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cholecystokinin Antibody (NBP2-62664) (0)

There are no reviews for Cholecystokinin Antibody (NBP2-62664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cholecystokinin Antibody (NBP2-62664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cholecystokinin Products

Bioinformatics Tool for Cholecystokinin Antibody (NBP2-62664)

Discover related pathways, diseases and genes to Cholecystokinin Antibody (NBP2-62664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cholecystokinin Antibody (NBP2-62664)

Discover more about diseases related to Cholecystokinin Antibody (NBP2-62664).

Pathways for Cholecystokinin Antibody (NBP2-62664)

View related products by pathway.

PTMs for Cholecystokinin Antibody (NBP2-62664)

Learn more about PTMs related to Cholecystokinin Antibody (NBP2-62664).

Research Areas for Cholecystokinin Antibody (NBP2-62664)

Find related products by research area.

Blogs on Cholecystokinin

There are no specific blogs for Cholecystokinin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cholecystokinin Antibody and receive a gift card or discount.


Gene Symbol CCK