Cholecystokinin Antibody - BSA Free

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Analysis in human duodenum and skeletal muscle tissues using Anti-CCK antibody. Corresponding CCK RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human hypothalamus shows strong positivity in neuronal projections.

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human skeletal muscle shows low expression as expected.

4% PFA fixed, frozen human small intestine samples. Cholecystokinin Antibody used at 1:200 dilution with 0.2% Triton X-100. Image from a verified customer review.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cholecystokinin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cholecystokinin Antibody - BSA Free (NBP2-62664) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cholecystokinin Antibody - BSA Free

• CCK
• cholecystokinin
• MGC117187

Background

The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for Cholecystokinin Antibody (NBP2-62664) (1)

Average Rating: 5

(Based on 1 review)

reviewed by: Verified Customer 10/16/2025

Summary

• Lot: 26039

Comments

• Comments: 4% PFA fixed, frozen human small intestine samples. CCK used at 1:200 dilution with 0.2% Triton X-100.

Bioinformatics

• Gene Symbol: CCK