Cholecystokinin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CCK |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviewed Applications |
Read 1 Review rated 5 using NBP2-62664 in the following applications:
|
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cholecystokinin Antibody - BSA Free
Background
The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: IHC
Publications for Cholecystokinin Antibody (NBP2-62664) (0)
There are no publications for Cholecystokinin Antibody (NBP2-62664).
By submitting your publication information earn gift cards and discounts for future purchases.
Review for Cholecystokinin Antibody (NBP2-62664) (1)
51
Average Rating: 5 (Based on 1 review)
Reviews using NBP2-62664:
Filter by Applications
All Applications
Filter by Species
All Species
| Images |
Ratings |
Applications |
Species |
Date |
Details |
|
|
5
reviewed by: Verified Customer
|
|
|
10/16/2025 |
Summary
Comments
| Comments | 4% PFA fixed, frozen human small intestine samples. CCK used at 1:200 dilution with 0.2% Triton X-100. |
|
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Cholecystokinin Antibody (NBP2-62664) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cholecystokinin Products
Research Areas for Cholecystokinin Antibody (NBP2-62664)
Find related products by research area.
|
Blogs on Cholecystokinin