Cholecystokinin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Analysis in human duodenum and skeletal muscle tissues using Anti-CCK antibody. Corresponding CCK RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human hypothalamus shows strong positivity in neuronal projections.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Cholecystokinin Antibody [NBP2-62664] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cholecystokinin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCK
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse (84%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Cholecystokinin Antibody

  • CCK
  • cholecystokinin
  • MGC117187

Background

The regulated translation of messenger RNA is essential for cell-cycle progression, establishment of the body plan during early development and modulation of key activities in the central nervous system. Cytoplasmic polyadenylation, one mechanism of controlling translation, is driven by cytoplasmic polyadenylation element binding protein, CPEB. CPEB is a highly conserved, sequence-specific RNA-binding protein that binds to the cytoplasmic polyadenylation element, thereby modulating translational repression and mRNA localization. Blocking cytoplasmic polyadenylation by interfering with the CPE or CPEB prevents the translational activation and translational repression of mRNAs crucial for oocyte maturation. CPEB is synthesized during oogenesis and stockpiled in the oocyte. CPEB degradation occurs via the proteasome pathway, most likely through ubiquitin-conjugated intermediates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cholecystokinin Antibody (NBP2-62664) (0)

There are no publications for Cholecystokinin Antibody (NBP2-62664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cholecystokinin Antibody (NBP2-62664) (0)

There are no reviews for Cholecystokinin Antibody (NBP2-62664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cholecystokinin Antibody (NBP2-62664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cholecystokinin Products

Research Areas for Cholecystokinin Antibody (NBP2-62664)

Find related products by research area.

Blogs on Cholecystokinin

There are no specific blogs for Cholecystokinin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cholecystokinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCK