NLE1 Antibody

Images

 
Western Blot: NLE1 Antibody [NBP1-83860] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: NLE1 Antibody [NBP1-83860] - Staining of human cell line A-431 shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: NLE1 Antibody [NBP1-83860] - Staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.
Western Blot: NLE1 Antibody [NBP1-83860] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NLE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NLE1 Protein (NBP1-83860PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NLE1 Antibody

  • FLJ10458
  • Nle
  • Notchless gene homolog
  • notchless homolog 1 (Drosophila)
  • notchless protein homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC

Publications for NLE1 Antibody (NBP1-83860) (0)

There are no publications for NLE1 Antibody (NBP1-83860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLE1 Antibody (NBP1-83860) (0)

There are no reviews for NLE1 Antibody (NBP1-83860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NLE1 Antibody (NBP1-83860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NLE1 Products

Bioinformatics Tool for NLE1 Antibody (NBP1-83860)

Discover related pathways, diseases and genes to NLE1 Antibody (NBP1-83860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NLE1 Antibody (NBP1-83860)

Discover more about diseases related to NLE1 Antibody (NBP1-83860).

Blogs on NLE1

There are no specific blogs for NLE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NLE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLE1