NKX3.1 Antibody (4X8T3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-234 of human NKX3.1 (Q99801). MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
NKX3-1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NKX3.1 Antibody (4X8T3)
Background
Nkx3.1 is a transcription factor that may play an important role in regulating proliferation of glandular epithelium and in the formation of ducts in the prostate. It has been thought to be one of the target genes of the 8p21 loss of heterozygosity, common in prostate cancer. But neither disruption of the coding region of the gene, nor mutations have been found in prostate cancer.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for NKX3.1 Antibody (NBP3-15883) (0)
There are no publications for NKX3.1 Antibody (NBP3-15883).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKX3.1 Antibody (NBP3-15883) (0)
There are no reviews for NKX3.1 Antibody (NBP3-15883).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NKX3.1 Antibody (NBP3-15883) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NKX3.1 Products
Research Areas for NKX3.1 Antibody (NBP3-15883)
Find related products by research area.
|
Blogs on NKX3.1