Nicotinamide N-Methyltransferase/NNMT Antibody

Images

 
Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human ...read more
Immunocytochemistry/ Immunofluorescence: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicotinamide N-Methyltransferase/NNMT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NNMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500-1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nicotinamide N-Methyltransferase/NNMT Protein (NBP2-32438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nicotinamide N-Methyltransferase/NNMT Antibody

  • EC 2.1.1.1
  • Nicotinamide NMethyltransferase
  • Nicotinamide N-Methyltransferase
  • NNMT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-16967
Species: Hu
Applications: WB, ICC/IF
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-82612
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP

Publications for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438) (0)

There are no publications for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438) (0)

There are no reviews for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinamide N-Methyltransferase/NNMT Products

Bioinformatics Tool for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438)

Discover related pathways, diseases and genes to Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438)

Discover more about diseases related to Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438).
 

Pathways for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438)

View related products by pathway.

PTMs for Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438)

Learn more about PTMs related to Nicotinamide N-Methyltransferase/NNMT Antibody (NBP2-32438).

Blogs on Nicotinamide N-Methyltransferase/NNMT

There are no specific blogs for Nicotinamide N-Methyltransferase/NNMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinamide N-Methyltransferase/NNMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NNMT
Entrez