MTRR Antibody


Western Blot: MTRR Antibody [NBP1-57749] - Antibody Titration: 1 ug/ml Positive control: Hela cell lysate.
Immunohistochemistry: MTRR Antibody [NBP1-57749] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 more
Western Blot: MTRR Antibody [NBP1-57749] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MTRR Antibody [NBP1-57749] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

MTRR Antibody Summary

Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against MTRR and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTRR Antibody

  • [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
  • 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
  • cblE
  • EC
  • methionine synthase reductase
  • methionine synthase reductase, mitochondrial
  • MGC129643
  • MSR


Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for MTRR Antibody (NBP1-57749) (0)

There are no publications for MTRR Antibody (NBP1-57749).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTRR Antibody (NBP1-57749) (0)

There are no reviews for MTRR Antibody (NBP1-57749). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTRR Antibody (NBP1-57749) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MTRR Products

Bioinformatics Tool for MTRR Antibody (NBP1-57749)

Discover related pathways, diseases and genes to MTRR Antibody (NBP1-57749). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTRR Antibody (NBP1-57749)

Discover more about diseases related to MTRR Antibody (NBP1-57749).

Pathways for MTRR Antibody (NBP1-57749)

View related products by pathway.

PTMs for MTRR Antibody (NBP1-57749)

Learn more about PTMs related to MTRR Antibody (NBP1-57749).

Blogs on MTRR

There are no specific blogs for MTRR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MTRR Antibody and receive a gift card or discount.


Gene Symbol MTRR