MTRR Antibody

Western Blot: MTRR Antibody [NBP1-57749] - Antibody Titration: 1 ug/ml Positive control: Hela cell lysate.

Immunohistochemistry: MTRR Antibody [NBP1-57749] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: MTRR Antibody [NBP1-57749] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: MTRR Antibody [NBP1-57749] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%

• Reactivity: Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, Rb
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MTRR Antibody Summary

• Immunogen: Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Guinea Pig (93%), Bovine (93%), Rabbit (100%), Canine (100%), Equine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTRR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
• Application Notes: This is a rabbit polyclonal antibody against MTRR and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTRR Antibody

• [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
• 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
• cblE
• EC 1.16.1.8
• methionine synthase reductase
• methionine synthase reductase, mitochondrial
• MGC129643
• MSR

Background

Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MTRR
• Uniprot:
  • Q9UBK8(Human)