SHMT1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining in human kidney and skeletal muscle tissues using NBP1-85437 antibody. Corresponding SHMT1 RNA-seq data are presented ...read more
Western Blot: SHMT1 Antibody [NBP1-85437] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: SHMT1 Antibody [NBP1-85437] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SHMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SHMT1 Protein (NBP1-85437PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85437 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SHMT1 Antibody

  • 14 kDa protein
  • CSHMT
  • cytoplasmic serine hydroxymethyltransferase
  • EC 2.1.2.1
  • Glycine hydroxymethyltransferase
  • MGC15229
  • MGC24556
  • serine hydroxymethyltransferase 1 (soluble)
  • serine hydroxymethyltransferase, cytosolic
  • Serine methylase
  • SHMT
  • SHMT1
  • SHMTEC 2.1.2.1

Background

SHMT1 encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SHMT1 Antibody (NBP1-85437) (0)

There are no publications for SHMT1 Antibody (NBP1-85437).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SHMT1 Antibody (NBP1-85437) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-85437:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot SHMT1 NBP1-85437
Enlarge
4
reviewed by:
Hua Jiang
WB Human 08/16/2021
View

Summary

ApplicationWestern Blot
Sample TestedLiver
SpeciesHuman
Lot000012720

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SHMT1 Antibody (NBP1-85437) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Hua Jiang
08/16/2021
Application: WB
Species: Human

Bioinformatics

Gene Symbol SHMT1