PEMT Antibody

Images

 
Immunohistochemistry: PEMT Antibody [NBP1-87297] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEMT Protein (NBP1-87297PEP)
Publications
Read Publication using NBP1-87297.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%). Rat (87%) Reactivity reported in scientific literature (PMID: 23451176)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEMT Antibody

  • EC 2.1.1.17
  • PEMPTMGC2483
  • PEMT2PEAMT
  • phosphatidylethanolamine N-methyltransferase
  • PNMT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA

Publications for PEMT Antibody (NBP1-87297)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for PEMT Antibody (NBP1-87297) (0)

There are no reviews for PEMT Antibody (NBP1-87297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEMT Antibody (NBP1-87297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEMT Products

Bioinformatics Tool for PEMT Antibody (NBP1-87297)

Discover related pathways, diseases and genes to PEMT Antibody (NBP1-87297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEMT Antibody (NBP1-87297)

Discover more about diseases related to PEMT Antibody (NBP1-87297).
 

Pathways for PEMT Antibody (NBP1-87297)

View related products by pathway.

PTMs for PEMT Antibody (NBP1-87297)

Learn more about PTMs related to PEMT Antibody (NBP1-87297).

Blogs on PEMT

There are no specific blogs for PEMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEMT