INMT Antibody - Azide and BSA Free

Western Blot: INMT Antibody [NBP3-04606] - Analysis of extracts of various cell lines, using INMT Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: INMT Antibody [NBP3-04606] - Analysis of L929 cells using INMT antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: INMT Antibody - Azide and BSA Free [NBP3-04606] - Immunofluorescence analysis of HeLa cells using INMT Rabbit pAb (A14391) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

INMT Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit INMT Antibody - Azide and BSA Free (NBP3-04606) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human INMT (NP_006765.4). MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INMT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for INMT Antibody - Azide and BSA Free

• Amine N-methyltransferase
• Aromatic alkylamine N-methyltransferase
• Arylamine N-methyltransferase
• EC 2.1.1
• EC 2.1.1.49
• Indolamine N-methyltransferase
• indolethylamine N-methyltransferase
• MGC125940
• MGC125941
• nicotine N-methyltransferase

Background

INMT is a gene which codes for a protein that functions as a thioether S-methyltransferase which is necessary in the detoxification of selenium compounds and the catalyzation of the N-methylations of tryptamine and compounds with similar structures and has two isoforms with lengths of 263 and 262 amino acids, that both have a weight of approximately 29 kDa. Current studies are being done on diseases and disorders relating to this gene including appendicitis, homosydteine, thryoditis, and carcinoma. INMT has also been shown to interact with KCNMA1, FMO1, IDO1, AANAT, and ABP1 in pathways such as the tryptophan metabolism and selenocompound metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: INMT