Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Reccomended Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate

Immunohistochemistry: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP1-55398] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NNMT(nicotinamide N-methyltransferase) The peptide sequence was selected from the N terminal of NNMT. Peptide sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NNMT
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

• EC 2.1.1.1
• Nicotinamide NMethyltransferase
• Nicotinamide N-Methyltransferase
• NNMT

Background

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NNMT
• Uniprot:
  • P40261(Human)