PEMT Antibody

Images

 
Western Blot: PEMT Antibody [NBP1-59580] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate
Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEMT Antibody Summary

Immunogen
Synthetic peptides corresponding to PEMT(phosphatidylethanolamine N-methyltransferase) The peptide sequence was selected from the C terminal of PEMT. Peptide sequence GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PEMT and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEMT Antibody

  • EC 2.1.1.17
  • PEMPTMGC2483
  • PEMT2PEAMT
  • phosphatidylethanolamine N-methyltransferase
  • PNMT

Background

PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PEMT Antibody (NBP1-59580) (0)

There are no publications for PEMT Antibody (NBP1-59580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEMT Antibody (NBP1-59580) (0)

There are no reviews for PEMT Antibody (NBP1-59580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEMT Antibody (NBP1-59580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PEMT Antibody (NBP1-59580)

Discover related pathways, diseases and genes to PEMT Antibody (NBP1-59580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEMT Antibody (NBP1-59580)

Discover more about diseases related to PEMT Antibody (NBP1-59580).
 

Pathways for PEMT Antibody (NBP1-59580)

View related products by pathway.

PTMs for PEMT Antibody (NBP1-59580)

Learn more about PTMs related to PEMT Antibody (NBP1-59580).

Blogs on PEMT

There are no specific blogs for PEMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEMT
Uniprot