PEMT Antibody


Western Blot: PEMT Antibody [NBP1-59580] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate
Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ye, ZeSpecies Glossary
Applications WB

Order Details

PEMT Antibody Summary

Synthetic peptides corresponding to PEMT(phosphatidylethanolamine N-methyltransferase) The peptide sequence was selected from the C terminal of PEMT. Peptide sequence GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PEMT and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEMT Antibody

  • EC
  • PEMPTMGC2483
  • phosphatidylethanolamine N-methyltransferase
  • PNMT


PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF

Publications for PEMT Antibody (NBP1-59580) (0)

There are no publications for PEMT Antibody (NBP1-59580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEMT Antibody (NBP1-59580) (0)

There are no reviews for PEMT Antibody (NBP1-59580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEMT Antibody (NBP1-59580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PEMT Products

Bioinformatics Tool for PEMT Antibody (NBP1-59580)

Discover related pathways, diseases and genes to PEMT Antibody (NBP1-59580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEMT Antibody (NBP1-59580)

Discover more about diseases related to PEMT Antibody (NBP1-59580).

Pathways for PEMT Antibody (NBP1-59580)

View related products by pathway.

PTMs for PEMT Antibody (NBP1-59580)

Learn more about PTMs related to PEMT Antibody (NBP1-59580).

Blogs on PEMT

There are no specific blogs for PEMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PEMT Antibody and receive a gift card or discount.


Gene Symbol PEMT