PEMT Antibody

Western Blot: PEMT Antibody [NBP1-59580] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate

Western Blot: PEMT Antibody [NBP1-59580] - Rat liver lysate.

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PEMT Antibody Summary

• Immunogen: Synthetic peptides corresponding to PEMT(phosphatidylethanolamine N-methyltransferase) The peptide sequence was selected from the C terminal of PEMT. Peptide sequence GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEMT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PEMT and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEMT Antibody

• EC 2.1.1.17
• PEMPTMGC2483
• PEMT2PEAMT
• phosphatidylethanolamine N-methyltransferase
• PNMT

Background

PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEMT
• Uniprot:
  • Q9BW86(Human)