Novus Biologicals products are now on bio-techne.com

NHS Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NHS Antibody [NBP2-56313] - Staining of human cell line RT4 shows localization to nuclear bodies & cell junctions.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NHS Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('ATYDSFLEKSPSDKADTSSHFSVDTEGYYTSMHFDCGLKGNKSYVCHYAALGPENGQGVGASPGLPDCAWQDYLDHKRQGRPSISFRKP',)
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NHS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NHS Recombinant Protein Antigen (NBP2-56313PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NHS Antibody

  • Congenital cataracts and dental anomalies protein
  • CXN
  • DKFZp781F2016
  • DKFZp781L0254
  • FLJ22511
  • Nance-Horan syndrome (congenital cataracts and dental anomalies)
  • Nance-Horan syndrome protein
  • SCML1

Background

The NHS gene encodes a protein containing four conserved nuclear localization signals. The encoded protein may function during the development of the eyes, teeth, and brain. Mutations in this gene have been shown to cause Nance-Horan syndrome. An alternative

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
AF5827
Species: Hu, Mu
Applications: WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
DY2037
Species: Hu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-47405
Species: Hu
Applications: IHC, IHC-P

Publications for NHS Antibody (NBP2-56313) (0)

There are no publications for NHS Antibody (NBP2-56313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHS Antibody (NBP2-56313) (0)

There are no reviews for NHS Antibody (NBP2-56313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NHS Antibody (NBP2-56313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHS Products

Array NBP2-56313

Research Areas for NHS Antibody (NBP2-56313)

Find related products by research area.

Blogs on NHS

There are no specific blogs for NHS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NHS