CREM Antibody (3B5)

Images

 
Western Blot: CREM Antibody (3B5) [H00001390-M02] - CREM monoclonal antibody (M02), clone 3B5. Analysis of CREM expression in human liver.
Immunocytochemistry/ Immunofluorescence: CREM Antibody (3B5) [H00001390-M02] - Analysis of monoclonal antibody to CREM on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: CREM Antibody (3B5) [H00001390-M02] - Detection limit for recombinant GST tagged CREM is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CREM Antibody (3B5) Summary

Immunogen
CREM (NP_853549 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Specificity
CREM (3B5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREM Antibody (3B5)

  • cAMP response element modulator
  • cAMP responsive element modulator
  • cAMP-responsive element modulator
  • hCREM 2alpha-b protein
  • hCREM 2beta-a protein
  • hCREM-2
  • ICER
  • inducible cAMP early repressor ICER
  • Inducible cAMP early repressor
  • MGC111110
  • MGC17881
  • MGC41893

Background

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00001390-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for CREM Antibody (H00001390-M02) (0)

There are no publications for CREM Antibody (H00001390-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREM Antibody (H00001390-M02) (0)

There are no reviews for CREM Antibody (H00001390-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CREM Antibody (H00001390-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CREM Products

Bioinformatics Tool for CREM Antibody (H00001390-M02)

Discover related pathways, diseases and genes to CREM Antibody (H00001390-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREM Antibody (H00001390-M02)

Discover more about diseases related to CREM Antibody (H00001390-M02).
 

Pathways for CREM Antibody (H00001390-M02)

View related products by pathway.

PTMs for CREM Antibody (H00001390-M02)

Learn more about PTMs related to CREM Antibody (H00001390-M02).

Blogs on CREM

There are no specific blogs for CREM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREM Antibody (3B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CREM
Entrez
OMIM
Uniprot