RNF130 Antibody

Images

 
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF130 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PWLSEHCTCPMCKLNILKALGIVPNLPCTDNVAFDMERLTRTQAVNRRSA
Specificity
Specificity of human RNF130 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF130
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF130 Protein (NBP1-81858PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF130 Antibody

  • E3 ubiquitin-protein ligase RNF130
  • EC 2.1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • g1-related zinc finger protein
  • G1RZFP
  • Goliath homolog
  • GOLIATH
  • GP
  • H-Goliath
  • MGC117241
  • MGC99542
  • ring finger protein 130MGC138647

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NBP1-84579
Species: Hu
Applications: IHC, IHC-P
NBP2-55197
Species: Hu
Applications: ICC/IF
NBP2-67416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6758
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-65904
Species: Hu, Ca, Md
Applications: Flow, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81858
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RNF130 Antibody (NBP1-81858) (0)

There are no publications for RNF130 Antibody (NBP1-81858).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF130 Antibody (NBP1-81858) (0)

There are no reviews for RNF130 Antibody (NBP1-81858). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF130 Antibody (NBP1-81858) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF130 Products

Bioinformatics Tool for RNF130 Antibody (NBP1-81858)

Discover related pathways, diseases and genes to RNF130 Antibody (NBP1-81858). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF130 Antibody (NBP1-81858)

Discover more about diseases related to RNF130 Antibody (NBP1-81858).
 

Pathways for RNF130 Antibody (NBP1-81858)

View related products by pathway.

PTMs for RNF130 Antibody (NBP1-81858)

Learn more about PTMs related to RNF130 Antibody (NBP1-81858).

Blogs on RNF130

There are no specific blogs for RNF130, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF130 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF130