NFYA Antibody - BSA Free

Western Blot: NFYA Antibody [NBP2-48977] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: NFYA Antibody [NBP2-48977] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NFYA Antibody [NBP2-48977] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-NFYA (NBP2-48977) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFYA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFYA Antibody - BSA Free (NBP2-48977) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEE
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFYA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NFYA Recombinant Protein Antigen (NBP2-48977PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NFYA Antibody - BSA Free

• CAAT box DNA-binding protein subunit A
• CBF-A
• CBF-B
• CCAAT-binding transcription factor subunit B
• FLJ11236
• HAP2 CCAAT-binding protein
• HAP2
• NF-YACAAT-box DNA binding protein subunit A
• Nuclear transcription factor Y subunit A
• nuclear transcription factor Y subunit alpha
• nuclear transcription factor Y, alpha
• Transcription factor NF-Y, A subunit

Background

The Y box is a CCAAT box which is bound by the heteromeric DNA binding protein, NFY (also known as CBF and CP1). Unlike the transcription factors C/EBP and CTF/NF1 which also bind CCAAT like sequences, NFY exhibits a strict binding requirement for this pentanucleotide sequence. Binding sites for this factor have been described for nearly 30% of all eukaryotic genes. Y/CCAAT sequences were frequently observed in the promoter proximal sequences. NF-Y is composed of 3 separate subunits (A,B and C) each of which is required for DNA binding. Each subunit has remained highly conserved throughout evolution. In fact, homologous yeast subunits can substitute for mammalian NF-Y in DNA-binding assays. The conserved core sequences of NF-YB and NF-YC contain a 70 aa region similar to the histone fold motif of nucleosomes H2A and H2B. The unique structure and evolutionary conservation of this transcription factor suggests that it plays a fundamental role in the readout of eukaryotic genetic information.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFYA