CYC1 Antibody

Images

 
Orthogonal Strategies: Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in human cell lines PC-3 and SK-MEL-30 using anti-CYC1 antibody. Corresponding CYC1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: CYC1 Antibody [NBP1-86872] - Staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: CYC1 Antibody [NBP1-86872] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in human cell line MCF-7.
Western Blot: CYC1 Antibody [NBP1-86872] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CYC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYR
Specificity
Specificity of human, mouse, rat CYC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYC1 Protein (NBP1-86872PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-86872 in the following applications:

Publications
Read Publications using
NBP1-86872 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYC1 Antibody

  • Complex III subunit 4
  • Complex III subunit IV
  • cytochrome c1, heme protein, mitochondrial
  • cytochrome c-1Cytochrome b-c1 complex subunit 4
  • Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit
  • UQCR4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-33582
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19533
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-19535
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, ChIP
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008847-P01
Species: Hu

Publications for CYC1 Antibody (NBP1-86872)(4)

Review for CYC1 Antibody (NBP1-86872) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-86872:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry CYC1 NBP1-86872
Enlarge
reviewed by:
Anonymous
ICC Rat 12/07/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedMCF-7
SpeciesRat
LotA08474

Blocking

Blocking DetailsBlocking with 3% BSA containing PBS for 30 min

Details

Detection NotesDetect in cofocal microscope

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYC1 Antibody (NBP1-86872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CYC1 Antibody (NBP1-86872)

Discover related pathways, diseases and genes to CYC1 Antibody (NBP1-86872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYC1 Antibody (NBP1-86872)

Discover more about diseases related to CYC1 Antibody (NBP1-86872).
 

Pathways for CYC1 Antibody (NBP1-86872)

View related products by pathway.

PTMs for CYC1 Antibody (NBP1-86872)

Learn more about PTMs related to CYC1 Antibody (NBP1-86872).

Blogs on CYC1

There are no specific blogs for CYC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
12/07/2015
Application: ICC
Species: Rat

Bioinformatics

Gene Symbol CYC1