NFkB p100/p52 Antibody

Images

 
Orthogonal Strategies: Western Blot: NFkB p100/p52 Antibody [NBP1-87760] - Analysis in human cell lines A-431 and HeLa using Anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: NFkB p100/p52 Antibody [NBP1-87760] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87760] - Staining in human appendix and skeletal muscle tissues using anti-NFKB2 antibody. Corresponding NFKB2 RNA-seq data are ...read more
Western Blot: NFkB p100/p52 Antibody [NBP1-87760] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87760] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: NFkB p100/p52 Antibody [NBP1-87760] - Staining of human skeletal muscle shows low expression as expected.
Simple Western: NFkB p100/p52 Antibody [NBP1-87760] - Simple Western lane view shows a specific band for NFKB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Simple Western: NFkB p100/p52 Antibody [NBP1-87760] - Electropherogram image(s) of corresponding Simple Western lane view. NFkB p100/p52 antibody was used at 1:30 dilution on RT4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NFkB p100/p52 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Specificity
Specificity of human, mouse, rat NFkB p100/p52 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Positive Control
NFkB p100/p52 Lysate (NBP2-64910)
NFkB p100/p52 Lysate (NBP2-66263)
Control Peptide
NFkB p100/p52 Protein (NBP1-87760PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NFkB p100/p52 Antibody

  • DNA-binding factor KBF2
  • H2TF1
  • Lymphocyte translocation chromosome 10 protein
  • Lyt10
  • LYT10LYT-10
  • nuclear factor NF-kappa-B p100 subunit
  • nuclear factor of kappa light chain gene enhancer in B-cells 2
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
  • Oncogene Lyt-10
  • p52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00027044-Q01
Species: Hu
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2698
Species: Hu
Applications: WB, IHC, ICC
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA

Publications for NFkB p100/p52 Antibody (NBP1-87760) (0)

There are no publications for NFkB p100/p52 Antibody (NBP1-87760).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFkB p100/p52 Antibody (NBP1-87760) (0)

There are no reviews for NFkB p100/p52 Antibody (NBP1-87760). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFkB p100/p52 Antibody (NBP1-87760) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NFkB p100/p52 Antibody (NBP1-87760)

Discover related pathways, diseases and genes to NFkB p100/p52 Antibody (NBP1-87760). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFkB p100/p52 Antibody (NBP1-87760)

Discover more about diseases related to NFkB p100/p52 Antibody (NBP1-87760).
 

Pathways for NFkB p100/p52 Antibody (NBP1-87760)

View related products by pathway.

PTMs for NFkB p100/p52 Antibody (NBP1-87760)

Learn more about PTMs related to NFkB p100/p52 Antibody (NBP1-87760).
 

Research Areas for NFkB p100/p52 Antibody (NBP1-87760)

Find related products by research area.

Blogs on NFkB p100/p52.

Nuclear Factor kappa B Signaling in the Immune System
Nuclear Factor kappa B (NFkB) binds to the kappa-beta site of the immunoglobulin kappa light chain gene enhancer. Thus NFkB has become one of the widely studied transcription factors in innate and adaptive immune responses. The NFkB family is composed...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFkB p100/p52 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKB2