Home » Neuroligin 3/NLGN3 » Neuroligin 3/NLGN3 Antibodies » Neuroligin 3/NLGN3 Antibody

Neuroligin 3/NLGN3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in control (vector only transfected HEK293T lysate) and NLGN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in control (vector only transfected HEK293T lysate) and NLGN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding NLGN3 RNA-seq data are presented for ...read more
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebral cortex shows moderate positivity.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Neuroligin 3/NLGN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Specificity
Specificity of human Neuroligin 3/NLGN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLGN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroligin 3/NLGN3 Antibody

  • ASPGX1
  • AUTSX1
  • Gliotactin homolog
  • HNL3
  • KIAA1480HNL3
  • Neuroligin 3
  • neuroligin-3
  • NL3
  • NLGN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neuroligin
4X/NLGN4X Antibody [U ...
AF5158
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Neuroligin 4X/NLGN4X Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5158) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neuroligin 4X/NLGN4X at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Neuroligin 4/NLGN4 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human Neuroligin 4/NLGN4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5158) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and their processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
Neuroligin 1/NLGN1
Antibody
AF4340
Western blot shows lysates of rat embryonic cortical neurons, rat embryonic hippocampal neurons, and human brain (cortex) tissue. PVDF membrane was probed with 0.1 µg/mL of Sheep Anti‑Rat Neuroligin 1/NLGN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4340) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neuroligin 1/NLGN1 at approximately 117 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Neuroligin 1/NLGN1 was detected in perfusion fixed frozen sections of rat brain (cortex) using Sheep Anti‑Rat Neuroligin 1/NLGN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4340) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to neuronal cell bodies, processes, and dendritic spines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Hu, Rt
Applications: WB, IHC
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
Neuroligin 2/NLGN2
Antibody
NBP2-41299
Western Blot: Neuroligin 2/NLGN2 Antibody [NBP2-41299] - Analysis of NLGN2 in rat brain tissue lysate with NLGN2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: Neuroligin 2/NLGN2 Antibody [NBP2-41299] - Mouse brain tissue with NLGN2 antibody at 20 ug/ml.
Immunohistochemistry-Paraffin: Neuroligin 2/NLGN2 Antibody [NBP2-41299] - Mouse brain tissue with NLGN2 antibody at 5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Acetylcholinesterase/A
NB100-1519
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - (0.3ug/ml) staining of Daudi (A), HeLa (B) and Jurkat (C) cell lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml), showing cytoplasmic and nuclear/Vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml).
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA
Neurexin 1
beta/NXRN1b Antibody
AF4524
Western blot shows lysates of rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Rat Neurexin 1 beta /NXRN1b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4524) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurexin 1 beta /NXRN1b at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Review)
Species: Rt
Applications: WB
Angiopoietin-like
Protein 4/ANGPTL4 Ant ...
NBP2-19016
Western Blot: ANGPTL4 Antibody [NBP2-19016] - WB analysis of ANGPTL4 in 1) Human pancreas 2) Human lung 3) Human lymph node 4) Human adipose and 5) Human breast cancer lysate.
Immunocytochemistry/Immunofluorescence: ANGPTL4 Antibody [NBP2-19016] - ANGPTL4 antibody was tested in U2OS cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Species: Hu, Mu
Applications: WB, ICC/IF

IGSF4A/SynCAM1/CADM1 A
NB300-186
Western Blot: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - Cells were transfected with the pCMV6-ENTRY control or pCMV6-ENTRY CADM1 cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SynCAM/CADM1.
Immunocytochemistry/Immunofluorescence: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - SynCAM/CADM1 antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - Rat brain and HEK cell lysates showing different glycosylation patterns. Brain fractions give banding patterns of a core glycosylation population around 50kDa and a slightly higher glycosylated population around 65 kDa. The heterologous HEK cell lysates give a single, fully glycosylated, band around 107kDa.
(1 Publication)
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, IHC
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Neurexin 3/NRXN3
Antibody
AF5269
Western blot shows lysates of mouse brain tissue and SH‑SY5Y human neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse Neurexin 3/NRXN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5269) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurexin 3/NRXN3 at approximately 160-170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu, Mu
Applications: WB, IHC
SHANK3 Antibody
(S69-46)
NBP1-47610
Western Blot: SHANK3 Antibody (S69-46) [NBP1-47610] - analysis of Rat brain membrane lysate showing detection of SHANK3 protein using Mouse Anti-SHANK3 Monoclonal Antibody, Clone S69-46. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: SHANK3 Antibody (S69-46) [NBP1-47610] - Tissue: HaCaT cells. Species: Human. Fixation: Cold 100% methanol for 10 minutes at -20C. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Borderline positive.
Immunohistochemistry-Paraffin: SHANK3 Antibody (S69-46) [NBP1-47610] - Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Early stages of filaggrinlike and dermal staining.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(16 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
BRD2 Antibody
NBP1-30475
Western Blot: BRD2 Antibody [NBP1-30475] - Detection of Human and Mouse BRD2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2ug/ml) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Arylsulfatase D
Antibody
NBP1-87486
Western Blot: Arylsulfatase D Antibody [NBP1-87486] - Analysis in control (vector only transfected HEK293T lysate) and ARSD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Tyrosine
Hydroxylase Antibody
NB300-109
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Dopamine neurons in the mouse substantia nigra. Image from confirmed customer review.
Immunocytochemistry/Immunofluorescence: Tyrosine Hydroxylase Antibody [NB300-109] - Analysis of Tyrosine Hydroxylase in rat mesenteric artery-whole. Image from verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Immunohistochemical staining of retina tissue using TH antibody, NB300-109.
(6 Reviews)
(109 Publications)
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
Neuroligin
4Y/NLGN4Y Overexpress ...
NBP2-10303
Western Blot: Neuroligin 4 Y-Linked Overexpression Lysate (Adult Normal) [NBP2-10303] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Neuroligin 4 Y-Linked.
Species: Hu
Nurr1/NGFI-B
beta/NR4A2 Antibody
NB110-40415
Western Blot: Nurr1 Antibody [NB110-40415] - Western blot detection of Nurr1 in 20 ug of human hippocampus tissue lysate (lanes 2 and 4) with Nurr1 polyclonal at 1:1000 dilution followed by AP-conjugated secondary at 1:5000 dilution. MW marker lane 1. Peptide absorption control lane 3.
Immunohistochemistry: Nurr1 Antibody [NB110-40415] - Nurr1 staining with Nurr1 polyclonal antibody at a 1:100 dilution in adult rat brain hippocampus. Tissue was fixed in paraformaldehyde and cut into 20 micron sections.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
Calnexin Antibody
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - A dilution of 1/2000 used in TBS with 0.05% Tween-20. Bands visualized by ECL using goat anti-rabbit HRP at 1:2000.
Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Mouse liver tissue using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Neuroligin 3/NLGN3 Products

Bioinformatics Tool for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover related pathways, diseases and genes to Neuroligin 3/NLGN3 Antibody (NBP1-90080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover more about diseases related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Pathways for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

View related products by pathway.

PTMs for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Learn more about PTMs related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Research Areas for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Find related products by research area.

Blogs on Neuroligin 3/NLGN3

There are no specific blogs for Neuroligin 3/NLGN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroligin 3/NLGN3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NLGN3