Neuroligin 3/NLGN3 Antibody - BSA Free

Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-90080 antibody. Corresponding NLGN3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebral cortex shows moderate positivity.

Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Analysis in human cell line NTERA-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neuroligin 3/NLGN3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neuroligin 3/NLGN3 Antibody - BSA Free (NBP1-90080) is a polyclonal antibody validated for use in IHC and WB. Anti-Neuroligin 3/NLGN3 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NLGN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Neuroligin 3/NLGN3 Protein (NBP1-90080PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID: 34040258).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neuroligin 3/NLGN3 Antibody - BSA Free

• ASPGX1
• AUTSX1
• Gliotactin homolog
• HNL3
• KIAA1480HNL3
• Neuroligin 3
• neuroligin-3
• NL3
• NLGN3

Background

Neuroligin 3 encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Mutations in this gene may be associated with autism and Asperger syndrome. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but their full length sequences have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080)(6)

Publications using NBP1-90080

• Yun EJ, Kim D, Kim S et al. Targeting Wnt/?-catenin-mediated upregulation of oncogenic NLGN3 suppresses cancer stem cells in glioblastoma Cell death & disease 2023-07-13 [PMID: 37443071] (Block/Neutralize)
• Ramirez M, Ninoyu Y, Miller C et al. Cochlear ribbon synapse maturation requires Nlgn1 and Nlgn3 iScience 2022-07-01 [PMID: 35992071] (IHC-P, Mouse)
• Anstey NJ, Kapgal V, Tiwari S et al. Imbalance of flight-freeze responses and their cellular correlates in the Nlgn3-/y rat model of autism Molecular autism 2022-07-18 [PMID: 35850732] (WB, Rat)
• Pan Y, Hysinger JD, Barron T et al. NF1 mutation drives neuronal activity-dependent initiation of optic glioma Nature 2021-05-26 [PMID: 34040258] (WB, Mouse)
  
  Details:
  Western blotting was performed using the Neuroligin 3/NLGN3 antibody with protein from the lysed optic nerve of mice. This allowed for the expression of NLGN3 in the optic nerves of Nf1OPG mice to be quantified relative to the wild-type mouse.
• T Takano, JT Wallace, KT Baldwin, AM Purkey, A Uezu, JL Courtland, EJ Soderblom, T Shimogori, PF Maness, C Eroglu, SH Soderling Chemico-genetic discovery of astrocytic control of inhibition in vivo Nature, 2020-11-11;0(0):. 2020-11-11 [PMID: 33177716]
• Subhramanyam CS, Cao Q, Wang C et al. Role of PIWI-like 4 in modulating neuronal differentiation from human embryonal carcinoma cells RNA Biol 2020-05-06 [PMID: 32372724]

Bioinformatics

• Gene Symbol: NLGN3