Neuroligin 3/NLGN3 Antibody

Images

 
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebellum shows cytoplasmic positivity in purkinje cells and in cells of granular layer).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuroligin 3/NLGN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLGN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuroligin 3/NLGN3 Protein (NBP1-90080PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroligin 3/NLGN3 Antibody

  • ASPGX1
  • AUTSX1
  • Gliotactin homolog
  • HNL3
  • KIAA1480HNL3
  • Neuroligin 3
  • neuroligin-3
  • NL3
  • NLGN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5158
Species: Hu
Applications: WB, IHC
AF4340
Species: Hu, Rt
Applications: WB, IHC
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF4524
Species: Rt
Applications: WB
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF5269
Species: Hu, Mu
Applications: WB, IHC
NBP1-47610
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90080
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuroligin 3/NLGN3 Products

Bioinformatics Tool for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover related pathways, diseases and genes to Neuroligin 3/NLGN3 Antibody (NBP1-90080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover more about diseases related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Pathways for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

View related products by pathway.

PTMs for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Learn more about PTMs related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Research Areas for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Find related products by research area.

Blogs on Neuroligin 3/NLGN3

There are no specific blogs for Neuroligin 3/NLGN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroligin 3/NLGN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLGN3
Entrez