Neuroligin 3/NLGN3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding NLGN3 RNA-seq data are presented for ...read more
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in control (vector only transfected HEK293T lysate) and NLGN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebral cortex shows moderate positivity.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neuroligin 3/NLGN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLGN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuroligin 3/NLGN3 Protein (NBP1-90080PEP)
Publications
Read Publications using
NBP1-90080 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID: 34040258).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroligin 3/NLGN3 Antibody

  • ASPGX1
  • AUTSX1
  • Gliotactin homolog
  • HNL3
  • KIAA1480HNL3
  • Neuroligin 3
  • neuroligin-3
  • NL3
  • NLGN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5158
Species: Hu
Applications: IHC, WB
AF4340
Species: Hu, Rt
Applications: IHC, WB
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
AF5645
Species: Hu, Rt
Applications: WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
AF4524
Species: Rt
Applications: WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB300-186
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF5269
Species: Hu, Mu
Applications: IHC, WB
NBP1-47610
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87486
Species: Hu
Applications: IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-93145
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080)(2)

Reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuroligin 3/NLGN3 Products

Bioinformatics Tool for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover related pathways, diseases and genes to Neuroligin 3/NLGN3 Antibody (NBP1-90080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover more about diseases related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Pathways for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

View related products by pathway.

PTMs for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Learn more about PTMs related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Research Areas for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Find related products by research area.

Blogs on Neuroligin 3/NLGN3

There are no specific blogs for Neuroligin 3/NLGN3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroligin 3/NLGN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLGN3