Home » Neuroligin 3/NLGN3 » Neuroligin 3/NLGN3 Antibodies » Neuroligin 3/NLGN3 Antibody

Neuroligin 3/NLGN3 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding NLGN3 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding NLGN3 RNA-seq data are presented for ...read more
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in control (vector only transfected HEK293T lysate) and NLGN3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Western Blot: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human cerebral cortex shows moderate positivity.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Neuroligin 3/NLGN3 Antibody [NBP1-90080] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Neuroligin 3/NLGN3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLGN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuroligin 3/NLGN3 Protein (NBP1-90080PEP)
Publications
Read Publications using
NBP1-90080 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID: 34040258).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuroligin 3/NLGN3 Antibody

  • ASPGX1
  • AUTSX1
  • Gliotactin homolog
  • HNL3
  • KIAA1480HNL3
  • Neuroligin 3
  • neuroligin-3
  • NL3
  • NLGN3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neuroligin
4X/NLGN4X Antibody [U ...
AF5158
Neuroligin 4/NLGN4 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Human Neuroligin 4/NLGN4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5158) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and their processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Neuroligin 4X/NLGN4X Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5158) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neuroligin 4X/NLGN4X at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(1 Publication)
Species: Hu
Applications: IHC, WB
Neuroligin 1/NLGN1
Antibody
AF4340
Western blot shows lysates of rat embryonic cortical neurons, rat embryonic hippocampal neurons, and human brain (cortex) tissue. PVDF membrane was probed with 0.1 µg/mL of Sheep Anti‑Rat Neuroligin 1/NLGN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4340) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neuroligin 1/NLGN1 at approximately 117 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Neuroligin 1/NLGN1 was detected in perfusion fixed frozen sections of rat brain (cortex) using Sheep Anti‑Rat Neuroligin 1/NLGN1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4340) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to neuronal cell bodies, processes, and dendritic spines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Hu, Rt
Applications: IHC, WB
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Neuroligin 2/NLGN2
Antibody [Unconjugate ...
AF5645
Western blot shows lysates of human cortex and rat cerebellum tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Rat Neuroligin 2/NLGN2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5645) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Neuroligin 2/NLGN2 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu, Rt
Applications: WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Staining (0.3ug/ml) of Jurkat (A) and (0.5ug/ml) HepG2 (B) cell lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Acetylcholinesterase/ACHE Antibody [NB100-1519] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml), showing nuclear, membrane and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2ug/ml).
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Neurexin 1
beta/NXRN1b Antibody
AF4524
Western blot shows lysates of rat spinal cord tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Rat Neurexin 1 beta /NXRN1b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4524) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurexin 1 beta /NXRN1b at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Review)
Species: Rt
Applications: WB
Angiopoietin-like
Protein 4/ANGPTL4 Ant ...
AF3485
Angiopoietin-like Protein 4/ANGPTL4 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB

IGSF4A/SynCAM1/CADM1 A
NB300-186
Simple Western: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - Simple Western lane view shows a specific band for SynCAM in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - Rat brain and HEK cell lysates showing different glycosylation patterns. Brain fractions give banding patterns of a core glycosylation population around 50kDa and a slightly higher glycosylated population around 65 kDa. The heterologous HEK cell lysates give a single, fully glycosylated, band around 107kDa.
Immunocytochemistry/Immunofluorescence: IGSF4A/SynCAM1/CADM1 Antibody [NB300-186] - SynCAM/CADM1 antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, Simple Western, WB

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu, Rt
Applications: IHC, WB
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human duodenum shows no positivity in glandular cells as expected.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Neurexin 3/NRXN3
Antibody
AF5269
Western blot shows lysates of mouse brain tissue and SH‑SY5Y human neuroblastoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse Neurexin 3/NRXN3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5269) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurexin 3/NRXN3 at approximately 160-170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu, Mu
Applications: IHC, WB
SHANK3 Antibody
(S69)
NBP1-47610
Immunocytochemistry/Immunofluorescence: SHANK3 Antibody (S69) [NBP1-47610] - Tissue: HaCaT cells. Species: Human. Fixation: Cold 100% methanol for 10 minutes at -20C. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Borderline positive.
Western Blot: SHANK3 Antibody (S69) [NBP1-47610] - Western Blot analysis of Rat brain membrane lysate showing detection of SHANK3 protein using Mouse Anti-SHANK3 Monoclonal Antibody, Clone S69-46 (NBP1-47610). Load: 15 ug. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody (NBP1-47610) at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry: SHANK3 Antibody (S69) [NBP1-47610] - Immunohistochemistry analysis using Mouse Anti-SHANK3 Monoclonal Antibody, Clone S69-46 (NBP1-47610). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-SHANK3 Monoclonal Antibody (NBP1-47610) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Early stages of filaggrin-like and dermal staining.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(25 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin: BRD2 Antibody [NBP1-30475] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-BRD2 (NBP1-30475). Detection: DAB
Immunocytochemistry/Immunofluorescence: BRD2 Antibody [NBP1-30475] - Formaldehyde-fixed asynchronous HeLa cells. Antibody: Affinity purified rabbit anti- BRD2 used at a dilution of 1:100 (2 ug/mL) (left) and rabbit anti-BRD2 recombinant monoclonal used at a dilution of 1:20 (right). Detection: Red-fluorescent goat anti-rabbit IgG cross-adsorbed Antibody DyLight 594 conjugated.
Immunoprecipitation: BRD2 Antibody [NBP1-30475] - Detection of human BRD2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-BRD2 antibody NBP1-30475 used for IP at 6 ug per reaction. BRD2 was also immunoprecipitated by rabbit anti-BRD2 antibody NBP1-30474 and rabbit anti-BRD2 recombinant monoclonal antibody [BL-167-2A2] (NBP2-76410). For blotting immunoprecipitated BRD2, NBP2-76410 was used at 1:1000. Detection: Chemiluminescence with an exposure time time of 3 minutes.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Arylsulfatase D
Antibody
NBP1-87486
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Western Blot: Arylsulfatase D Antibody [NBP1-87486] - Analysis in control (vector only transfected HEK293T lysate) and ARSD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.
Species: Hu
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(173 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Neuroligin
4Y/NLGN4Y Antibody
NBP2-93145
Western Blot: Neuroligin 4Y/NLGN4Y Antibody [NBP2-93145] - Analysis of extracts of various cell lines, using Neuroligin 4Y/NLGN4Y at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Immunohistochemistry-Paraffin: Neuroligin 4Y/NLGN4Y Antibody [NBP2-93145] - Paraffin-embedded human prostate using Neuroligin 4Y/NLGN4Y .
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. Staining was performed using our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Nurr1/NGFI‑B beta /NR4A2 was detected in immersion fixed paraffin-embedded sections of mouse brain (hippocampus) using Goat Anti-Human/Mouse Nurr1/NGFI‑B beta /NR4A2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2156) at 15 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in neurons. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(6 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Calnexin Antibody
- BSA Free
NB100-1965
Western Blot: Calnexin Antibody [NB100-1965] - Subcellular localization of TM6SF2.Immunoaffinity isolation of ER and Golgi complex from mouse liver. ER and Golgi fractions were prepared from mouse liver microsomes by immunoaffinity chromatography as described under Experimental Procedures. Microsome membranes were dissolved in RIPA buffer, and equal volumes were separated on 10% SDS-PAGE and immunoblotting as described under Experimental Procedures. BiP, binding immunoglobulin protein; Gos28, Golgi SNAP receptor complex member 1; *, nonspecific band. Image collected and cropped by Citeab from the following publication (Inactivation of Tm6sf2, a Gene Defective in Fatty Liver Disease, Impairs Lipidation but Not Secretion of Very Low Density Lipoproteins. J Biol Chem (2016) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - Calnexin immunostaining in the anterior (AI) and mid (MI) intestine of ctrl (control zebrafish), D.I.O. (diet-induced obesity zebrafish), D.I.O. flw 3,5-T2 (D.I.O. zebrafish followed by 3,5-T2), D.I.O. with 3,5-T2 (D.I.O. zebrafish treated with 3,5-T2). (A) AI of ctrl zebrafish (B) AI of D.I.O. (C) AI of D.I.O. flw 3,5-T2. (D) AI of D.I.O. with 3,5-T2. The arrows indicate calnexin immunoexpression in the enteroendocrine and goblet cells. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2076-2615/10/7/1131/htm#) licensed under a CC-BY licence.
Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.
(3 Reviews)
(30 Publications)
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Tissue section of mouse pancreas using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in majority of the cells from acini, ducts and Islets of Langerhans in the section.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Neuroligin 3/NLGN3 Antibody (NBP1-90080)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no reviews for Neuroligin 3/NLGN3 Antibody (NBP1-90080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuroligin 3/NLGN3 Antibody (NBP1-90080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuroligin 3/NLGN3 Products

Bioinformatics Tool for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover related pathways, diseases and genes to Neuroligin 3/NLGN3 Antibody (NBP1-90080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Discover more about diseases related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Pathways for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

View related products by pathway.

PTMs for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Learn more about PTMs related to Neuroligin 3/NLGN3 Antibody (NBP1-90080).
 

Research Areas for Neuroligin 3/NLGN3 Antibody (NBP1-90080)

Find related products by research area.

Blogs on Neuroligin 3/NLGN3

There are no specific blogs for Neuroligin 3/NLGN3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuroligin 3/NLGN3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NLGN3