Arylsulfatase D Antibody

Images

 
Western Blot: Arylsulfatase D Antibody [NBP1-87486] - Analysis in control (vector only transfected HEK293T lysate) and ARSD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arylsulfatase D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
Specificity
Specificity of human Arylsulfatase D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arylsulfatase D Antibody

  • arylsulfatase D
  • ASD
  • EC 3.1.6.-
  • EC 3.1.6.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
AF4479
Species: Hu
Applications: IHC
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB4415
Species: Hu
Applications: WB, ICC
7270-IL/CF
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02410
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-76346
Species: Mu, Rt
Applications: Flow, PEP-ELISA, IF
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no publications for Arylsulfatase D Antibody (NBP1-87486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no reviews for Arylsulfatase D Antibody (NBP1-87486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Arylsulfatase D Products

Bioinformatics Tool for Arylsulfatase D Antibody (NBP1-87486)

Discover related pathways, diseases and genes to Arylsulfatase D Antibody (NBP1-87486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arylsulfatase D Antibody (NBP1-87486)

Discover more about diseases related to Arylsulfatase D Antibody (NBP1-87486).
 

Pathways for Arylsulfatase D Antibody (NBP1-87486)

View related products by pathway.

Research Areas for Arylsulfatase D Antibody (NBP1-87486)

Find related products by research area.

Blogs on Arylsulfatase D

There are no specific blogs for Arylsulfatase D, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arylsulfatase D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSD
COVID-19 update