Arylsulfatase D Antibody

Images

 
Western Blot: Arylsulfatase D Antibody [NBP1-87486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: Arylsulfatase D Antibody [NBP1-87486] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.
Immunohistochemistry-Paraffin: Arylsulfatase D Antibody [NBP1-87486] - Staining of human liver shows strong cytoplasmic positivity with a granular pattern in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arylsulfatase D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Arylsulfatase D Protein (NBP1-87486PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arylsulfatase D Antibody

  • arylsulfatase D
  • ASD
  • EC 3.1.6.-
  • EC 3.1.6.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF2485
Species: Hu
Applications: WB, IHC, IP
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4415
Species: Hu
Applications: WB, ICC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-28487
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no publications for Arylsulfatase D Antibody (NBP1-87486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no reviews for Arylsulfatase D Antibody (NBP1-87486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Arylsulfatase D Antibody (NBP1-87486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arylsulfatase D Products

Bioinformatics Tool for Arylsulfatase D Antibody (NBP1-87486)

Discover related pathways, diseases and genes to Arylsulfatase D Antibody (NBP1-87486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arylsulfatase D Antibody (NBP1-87486)

Discover more about diseases related to Arylsulfatase D Antibody (NBP1-87486).
 

Pathways for Arylsulfatase D Antibody (NBP1-87486)

View related products by pathway.

Research Areas for Arylsulfatase D Antibody (NBP1-87486)

Find related products by research area.

Blogs on Arylsulfatase D

There are no specific blogs for Arylsulfatase D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arylsulfatase D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSD