Neurocan Antibody

Images

 
Immunohistochemistry-Paraffin: Neurocan Antibody [NBP1-84368] - Staining of human cerebral cortex shows distinct neuropil positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neurocan Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neurocan Protein (NBP1-84368PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurocan Antibody

  • chondroitin sulfate proteoglycan 3 (neurocan)
  • Chondroitin sulfate proteoglycan 3
  • CSPG3
  • CSPG3neurocan core protein
  • FLJ44681
  • NCAN
  • NEUR
  • neurocan proteoglycan
  • Neurocan

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2688
Species: Hu
Applications: WB
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NBP2-57712
Species: Hu
Applications: ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Neurocan Antibody (NBP1-84368) (0)

There are no publications for Neurocan Antibody (NBP1-84368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurocan Antibody (NBP1-84368) (0)

There are no reviews for Neurocan Antibody (NBP1-84368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurocan Antibody (NBP1-84368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurocan Products

Bioinformatics Tool for Neurocan Antibody (NBP1-84368)

Discover related pathways, diseases and genes to Neurocan Antibody (NBP1-84368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurocan Antibody (NBP1-84368)

Discover more about diseases related to Neurocan Antibody (NBP1-84368).
 

Pathways for Neurocan Antibody (NBP1-84368)

View related products by pathway.

PTMs for Neurocan Antibody (NBP1-84368)

Learn more about PTMs related to Neurocan Antibody (NBP1-84368).

Blogs on Neurocan

There are no specific blogs for Neurocan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurocan Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAN
Entrez