Neurocan Antibody - BSA Free

Immunohistochemistry-Paraffin: Neurocan Antibody [NBP1-84368] - Staining in human cerebral cortex and pancreas tissues using anti-NCAN antibody. Corresponding NCAN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Neurocan Antibody [NBP1-84368] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Neurocan Antibody [NBP1-84368] - Staining of human cerebral cortex shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neurocan Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neurocan Antibody - BSA Free (NBP1-84368) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDASERGLHMQKLGSGSVQAALAELVALPCLFTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCAN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Neurocan Protein (NBP1-84368PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neurocan Antibody - BSA Free

• chondroitin sulfate proteoglycan 3 (neurocan)
• Chondroitin sulfate proteoglycan 3
• CSPG3
• CSPG3neurocan core protein
• FLJ44681
• NCAN
• NEUR
• neurocan proteoglycan
• Neurocan

Background

Neurocan is the major soluble chondroitin sulfate proteoglycan in the brain. It is thought to play a functional role in axonal growth and guidance and in the establishment of specific neural pathways during embryonic brain development. Neurocan expression in the brain is developmentally regulated. Early on the major form of Neurocan consists of a 245kD core protein with approximately two chondroitin sulfate glycosoaminoglycan chains of 22kD each. Later Neurocan comprises a 180kD core protein Both forms of Neurocan contain only chondroitin 4-sulfate glycosoaminoglycan chains. By virtue of their high expression at sites of neural damage and trauma, chondroitin sulfate proteoglycans, including Neurocan, are thought to inhibit successful nerve regeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCAN