Netrin-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Netrin-1 Antibody - BSA Free (NBP2-31640) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NTN1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Netrin-1 Antibody - BSA Free
Background
Semaphorins, neuropilins and netrins are among a number of molecules and their receptors that regulate the developing nervous system to guide the development of neural circuits.1 Although first identified as axon guidance cues,2,3 it is now apparent that many of these same factors are not limited to the guidance of growing axons, but have roles in a range of processes from the guidance of cell migration to the regulation of the immune response, angiogenesis, lung branching morphogenesis, nervous system regeneration, and cancer.4-9 The semaphorins make up the largest family of axon guidance cues. They are characterized by the presence of an approximately 500 amino acid N-terminal semaphorin (Sema) domain. Semaphorins function mainly as chemorepellents that direct axons away from tissues.3 Semaphorin 3A (Sema3A) has been shown to be repellent to cortical axons and to inhibit axon branching.10 The transmembrane protein semaphorin 6A has been shown to repel embryonic sympathetic axons.11 The actions of the various semaphorins are not always similar. Semaphorin 3A has been found to inhibit tumor development whereas semaphorin 6A may contribute to tumor progression.9 Neuropilins are the ligand binding moieties in the class 3 Semaphorin receptor complexes that subsequently activate signaling through associated plexins. Two types have been identified so far: Neuropilin-1 (Npn-1) and Neuropilin-2 (Npn-2) receptors. At the amino acid sequence level, Npn-1 and Npn-2 share 44% identity. Npn-1 and Npn-2 show different expression patterns in developing neurons of the central and peripheral nervous systems, and show different binding specificities for different members of he semaphorin family. Both also function as receptors for some forms of vascular endothelial growth factor (VEGF).12 Netrins are a family of laminin-related small proteins that are involved in axon guidance and eurite outgrowth. Netrin-1 has been shown to attract cortical growth cones and promote axon branching.10 Netrin-4 (first named b-netrin) was found to promote neurite elongation from olfactory bulb explants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Block, IHC, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Mu
Applications: BA
Species: Mu
Applications: IHC
Species: Rt
Applications: Block, ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Mu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Netrin-1 Antibody (NBP2-31640) (0)
There are no publications for Netrin-1 Antibody (NBP2-31640).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Netrin-1 Antibody (NBP2-31640) (0)
There are no reviews for Netrin-1 Antibody (NBP2-31640).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Netrin-1 Antibody (NBP2-31640) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Netrin-1 Products
Research Areas for Netrin-1 Antibody (NBP2-31640)
Find related products by research area.
|
Blogs on Netrin-1