Netrin-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Netrin-1 Antibody [NBP2-31640] - Staining of human cerebral cortex shows cytoplasmic positivity in processes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Netrin-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Netrin-1 Protein (NBP2-31640PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Netrin-1 Antibody

  • netrin 1
  • Netrin1
  • Netrin-1
  • NTN1
  • NTN1Lnetrin 1, mouse, homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: WB, Block
AF1006
Species: Rt
Applications: WB, IHC
AF1005
Species: Hu
Applications: WB, IHC
AF1079
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Block
NBP2-20398
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
AF3629
Species: Hu, Mu, Rt
Applications: WB, Neut
AF1405
Species: Rt
Applications: WB, Block, ICC
6514-SL
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1166
Species: Mu
Applications: WB
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-31640
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Netrin-1 Antibody (NBP2-31640) (0)

There are no publications for Netrin-1 Antibody (NBP2-31640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-1 Antibody (NBP2-31640) (0)

There are no reviews for Netrin-1 Antibody (NBP2-31640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Netrin-1 Antibody (NBP2-31640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Netrin-1 Products

Bioinformatics Tool for Netrin-1 Antibody (NBP2-31640)

Discover related pathways, diseases and genes to Netrin-1 Antibody (NBP2-31640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Netrin-1 Antibody (NBP2-31640)

Discover more about diseases related to Netrin-1 Antibody (NBP2-31640).
 

Pathways for Netrin-1 Antibody (NBP2-31640)

View related products by pathway.

PTMs for Netrin-1 Antibody (NBP2-31640)

Learn more about PTMs related to Netrin-1 Antibody (NBP2-31640).
 

Research Areas for Netrin-1 Antibody (NBP2-31640)

Find related products by research area.

Blogs on Netrin-1

There are no specific blogs for Netrin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Netrin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN1
Entrez
Uniprot