Nesfatin-1/Nucleobindin-2 Antibody

Images

 
Genetic Strategies: Western Blot: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: Nesfatin-1/Nucleobindin-2 Antibody [NBP1-87383] - Analysis in human cell line HL-60.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Nesfatin-1/Nucleobindin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSEVDTNKDRLVTLEEFLKATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUCB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nesfatin-1/Nucleobindin-2 Protein (NBP1-87383PEP)
Publications
Read Publications using
NBP1-87383 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31670281). Rat (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nesfatin-1/Nucleobindin-2 Antibody

  • DNA-binding protein NEFA
  • NEFA
  • NEFAGastric cancer antigen Zg4
  • Nesfatin1
  • Nesfatin-1
  • NUCB2
  • nucleobindin 2
  • Nucleobindin-2
  • nucleobinding 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
MAB6967
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-92630
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-87383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383)(3)

Reviews for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383) (0)

There are no reviews for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nesfatin-1/Nucleobindin-2 Products

Bioinformatics Tool for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383)

Discover related pathways, diseases and genes to Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383)

Discover more about diseases related to Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383).
 

Pathways for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383)

View related products by pathway.

PTMs for Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383)

Learn more about PTMs related to Nesfatin-1/Nucleobindin-2 Antibody (NBP1-87383).

Blogs on Nesfatin-1/Nucleobindin-2

There are no specific blogs for Nesfatin-1/Nucleobindin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nesfatin-1/Nucleobindin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUCB2