NDUFB8 Antibody - BSA Free

Western Blot: NDUFB8 Antibody [NBP1-88859] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP1-88859] - Staining of human heart muscle shows strong granular positivity in myocytes.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western Reported in (PMID:35641783)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDUFB8 Protein (NBP1-88859PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFB8 Antibody - BSA Free

• CI-ASHImitochondrial
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
• NADH:ubiquinone oxidoreductase ASHI subunit
• NADH-ubiquinone oxidoreductase ASHI subunit

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFB8 Antibody (NBP1-88859)(1)

Publication using NBP1-88859

• Moreau, M, Capallere, C, et al. Reconstruction of functional human epidermis equivalent containing 5%IPS-derived keratinocytes treated with mitochondrial stimulating plant extracts. Sci Rep [PMID: 35641783] (Simple Western, Human)
  
  Details:
  0.180555556

Bioinformatics

• Gene Symbol: NDUFB8