UQCRFS1 Antibody - BSA Free

Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar pattern to independent antibody NBP2-38623 (B).

Immunocytochemistry/Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.

Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.

Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining in human heart muscle and pancreas tissues . Corresponding UQCRFS1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein distribution across tissues to independent antibody NBP2-38623 (B).

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.

Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.

Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu, Rt, Mu
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

UQCRFS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit UQCRFS1 Antibody - BSA Free (NBP1-87826) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-UQCRFS1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRFS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in the literature (PMID:25605331). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 31 kDa
• Control Peptide:

  UQCRFS1 Protein (NBP1-87826PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for UQCRFS1 Antibody - BSA Free

• Complex III subunit 5
• Cytochrome b-c1 complex subunit 5
• cytochrome b-c1 complex subunit Rieske, mitochondrial
• EC 1.10.2.2
• Rieske iron-sulfur protein
• RIP1
• RIS1
• RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
• ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
• UQCR5

Background

RIP1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Function: The transit peptide of the Rieske protein seems

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for UQCRFS1 Antibody (NBP1-87826)(2)

Publications using NBP1-87826

• Iommarini L, Ghelli A, Leone G, Tropeano CV et al. Mild phenotypes and proper supercomplex assembly in human cells carrying the homoplasmic m.15557G>A mutation in cytochrome b gene Hum. Mutat. 2017-10-01 [PMID: 28967163]
• Desmurs M, Foti M, Raemy E et al. C11orf83, a Mitochondrial Cardiolipin-Binding Protein Involved in bc1 Complex Assembly and Supercomplex Stabilization. Mol Cell Biol 2015-04-01 [PMID: 25605331] (WB, Human)

Bioinformatics

• Gene Symbol: UQCRFS1