Independent Antibodies: Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar pattern to independent antibody NBP2-38623 (B).
Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining in human heart muscle and pancreas tissues . Corresponding UQCRFS1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).
This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRFS1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
WB reported in the literature (PMID:25605331). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 31 kDa
RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
UQCR5
Background
RIP1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Function: The transit peptide of the Rieske protein seems
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our UQCRFS1 Antibody - BSA Free and receive a gift card or discount.