UQCRFS1 Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar pattern to independent antibody NBP2-38623 (B).
Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis using Anti-UQCRFS1 antibody NBP1-87826.
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining in human heart muscle and pancreas tissues . Corresponding UQCRFS1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon, kidney, liver and testis using Anti-UQCRFS1 antibody NBP1-87826 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human liver.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human colon.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney using Anti-UQCRFS1 antibody NBP1-87826.
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

UQCRFS1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit UQCRFS1 Antibody - BSA Free (NBP1-87826) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-UQCRFS1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:30
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in the literature (PMID:25605331). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 31 kDa
Control Peptide
UQCRFS1 Protein (NBP1-87826PEP)
Publications
Read Publications using
NBP1-87826 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRFS1 Antibody - BSA Free

  • Complex III subunit 5
  • Cytochrome b-c1 complex subunit 5
  • cytochrome b-c1 complex subunit Rieske, mitochondrial
  • EC 1.10.2.2
  • Rieske iron-sulfur protein
  • RIP1
  • RIS1
  • RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
  • ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  • UQCR5

Background

RIP1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Function: The transit peptide of the Rieske protein seems

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-77299
Species: Hu, Mu, Rt
Applications: ELISA, GS, ICC/IF, IHC,  IHC-P, IP, KD, KO, Simple Western, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00010928-M02
Species: Hu, Xp
Applications: ELISA, ICC/IF, IP, WB
NBP1-86344
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-15951
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-27203
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
NBP1-76749
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
DRT100
Species: Hu
Applications: ELISA
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for UQCRFS1 Antibody (NBP1-87826)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UQCRFS1 Antibody (NBP1-87826) (0)

There are no reviews for UQCRFS1 Antibody (NBP1-87826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UQCRFS1 Antibody (NBP1-87826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRFS1 Products

Research Areas for UQCRFS1 Antibody (NBP1-87826)

Find related products by research area.

Blogs on UQCRFS1

There are no specific blogs for UQCRFS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRFS1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol UQCRFS1