UQCRFS1 Antibody

Images

 
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: UQCRFS1 Antibody [NBP1-87826] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: UQCRFS1 Antibody [NBP1-87826] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: UQCRFS1 Antibody [NBP1-87826] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Simple Western lane view shows a specific band for RIP1 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: UQCRFS1 Antibody [NBP1-87826] - Electropherogram image(s) of corresponding Simple Western lane view. UQCRFS1 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UQCRFS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UQCRFS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:30
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
UQCRFS1 Protein (NBP1-87826PEP)
Publications
Read Publication using
NBP1-87826 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25605331).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UQCRFS1 Antibody

  • Complex III subunit 5
  • Cytochrome b-c1 complex subunit 5
  • cytochrome b-c1 complex subunit Rieske, mitochondrial
  • EC 1.10.2.2
  • Rieske iron-sulfur protein
  • RIP1
  • RIS1
  • RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
  • ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  • UQCR5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-87826
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for UQCRFS1 Antibody (NBP1-87826)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for UQCRFS1 Antibody (NBP1-87826) (0)

There are no reviews for UQCRFS1 Antibody (NBP1-87826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UQCRFS1 Antibody (NBP1-87826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRFS1 Products

Bioinformatics Tool for UQCRFS1 Antibody (NBP1-87826)

Discover related pathways, diseases and genes to UQCRFS1 Antibody (NBP1-87826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRFS1 Antibody (NBP1-87826)

Discover more about diseases related to UQCRFS1 Antibody (NBP1-87826).
 

Pathways for UQCRFS1 Antibody (NBP1-87826)

View related products by pathway.

PTMs for UQCRFS1 Antibody (NBP1-87826)

Learn more about PTMs related to UQCRFS1 Antibody (NBP1-87826).
 

Research Areas for UQCRFS1 Antibody (NBP1-87826)

Find related products by research area.

Blogs on UQCRFS1

There are no specific blogs for UQCRFS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRFS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UQCRFS1