CAP1 Antibody

Images

 
Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: CAP1 Antibody [NBP1-86644] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human tonsil shows moderate cytoplasmic/ membranous positivity in non-germinal center cells.
Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells outside the reaction centres and moderate to strong cytoplasmic and membranous ...read more
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human prostate shows moderate cytoplasmic/ membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAP1 Protein (NBP1-86644PEP)
Publications
Read Publication using
NBP1-86644 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAP1 Antibody

  • adenylyl cyclase-associated protein 1
  • CAP, adenylate cyclase-associated protein 1 (yeast)
  • CAP1
  • CAP1-PEN
  • CAPCAP 1
  • SSKAP55

Background

CAP1 is encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1707
Species: Hu
Applications: ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-97417
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), IHC, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
AF5535
Species: Hu
Applications: Simple Western, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-30572
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-89200
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for CAP1 Antibody (NBP1-86644)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CAP1 Antibody (NBP1-86644) (0)

There are no reviews for CAP1 Antibody (NBP1-86644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAP1 Antibody (NBP1-86644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAP1 Products

Diseases for CAP1 Antibody (NBP1-86644)

Discover more about diseases related to CAP1 Antibody (NBP1-86644).
 

Pathways for CAP1 Antibody (NBP1-86644)

View related products by pathway.

PTMs for CAP1 Antibody (NBP1-86644)

Learn more about PTMs related to CAP1 Antibody (NBP1-86644).
 

Research Areas for CAP1 Antibody (NBP1-86644)

Find related products by research area.

Blogs on CAP1

There are no specific blogs for CAP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAP1