CAP1 Antibody

Images

 
Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: CAP1 Antibody [NBP1-86644] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CAP1 Antibody [NBP1-86644] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells outside the reaction centres and moderate to strong cytoplasmic and membranous ...read more
Western Blot: CAP1 Antibody [NBP1-86644] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAP1 Protein (NBP1-86644PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAP1 Antibody

  • adenylyl cyclase-associated protein 1
  • CAP, adenylate cyclase-associated protein 1 (yeast)
  • CAP1
  • CAP1-PEN
  • CAPCAP 1
  • SSKAP55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF6386
Species: Hu
Applications: WB, IP
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
AF5535
Species: Hu
Applications: WB, Simple Western
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-30572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA

Publications for CAP1 Antibody (NBP1-86644) (0)

There are no publications for CAP1 Antibody (NBP1-86644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAP1 Antibody (NBP1-86644) (0)

There are no reviews for CAP1 Antibody (NBP1-86644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAP1 Antibody (NBP1-86644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAP1 Products

Bioinformatics Tool for CAP1 Antibody (NBP1-86644)

Discover related pathways, diseases and genes to CAP1 Antibody (NBP1-86644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAP1 Antibody (NBP1-86644)

Discover more about diseases related to CAP1 Antibody (NBP1-86644).
 

Pathways for CAP1 Antibody (NBP1-86644)

View related products by pathway.

PTMs for CAP1 Antibody (NBP1-86644)

Learn more about PTMs related to CAP1 Antibody (NBP1-86644).
 

Research Areas for CAP1 Antibody (NBP1-86644)

Find related products by research area.

Blogs on CAP1

There are no specific blogs for CAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAP1
Entrez