NDUFB8 Antibody

Images

 
Western Blot: NDUFB8 Antibody [NBP1-88859] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP1-88859] - Staining of human heart muscle shows strong granular positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFB8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFB8 Protein (NBP1-88859PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFB8 Antibody

  • CI-ASHImitochondrial
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
  • NADH:ubiquinone oxidoreductase ASHI subunit
  • NADH-ubiquinone oxidoreductase ASHI subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004700-R01
Species: Hu
NBP1-88859
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NDUFB8 Antibody (NBP1-88859) (0)

There are no publications for NDUFB8 Antibody (NBP1-88859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB8 Antibody (NBP1-88859) (0)

There are no reviews for NDUFB8 Antibody (NBP1-88859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB8 Antibody (NBP1-88859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB8 Products

Bioinformatics Tool for NDUFB8 Antibody (NBP1-88859)

Discover related pathways, diseases and genes to NDUFB8 Antibody (NBP1-88859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB8 Antibody (NBP1-88859)

Discover more about diseases related to NDUFB8 Antibody (NBP1-88859).
 

Pathways for NDUFB8 Antibody (NBP1-88859)

View related products by pathway.

PTMs for NDUFB8 Antibody (NBP1-88859)

Learn more about PTMs related to NDUFB8 Antibody (NBP1-88859).
 

Research Areas for NDUFB8 Antibody (NBP1-88859)

Find related products by research area.

Blogs on NDUFB8

There are no specific blogs for NDUFB8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB8