Novus Biologicals products are now on bio-techne.com

MRPS30 Antibody

Images

 
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human breast shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human thyroid gland shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS30
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPS30 Protein (NBP1-87343PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS30 Antibody

  • 28S ribosomal protein S30, mitochondrial
  • DKFZp566B2024
  • mitochondrial ribosomal protein S30
  • MRP-S30
  • PAP
  • PDCD9
  • programmed cell death 9
  • Programmed cell death protein 9
  • S30mt

Background

MRPS30, or Mitochondrial Ribosomal Protein S30, consists of a 439 amino acid isoform that is 50 kDa, and is involved in mitochondrial protein synthesis in the heart, skeletal muscles, kidney, and liver. Current disease research is being conducted on MRPS30 and its relation to breast cancer, neuronitis, and prostatitis. MRPS30 has been linked to translation and apoptosis, through which it interacts with ICT1, MAGEA11, AARS2, AASS, and ABCB7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
H00005670-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DTPA00
Species: Hu
Applications: ELISA

Publications for MRPS30 Antibody (NBP1-87343) (0)

There are no publications for MRPS30 Antibody (NBP1-87343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS30 Antibody (NBP1-87343) (0)

There are no reviews for MRPS30 Antibody (NBP1-87343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS30 Antibody (NBP1-87343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS30 Products

Research Areas for MRPS30 Antibody (NBP1-87343)

Find related products by research area.

Blogs on MRPS30

There are no specific blogs for MRPS30, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS30