NDRG2 Antibody - BSA Free

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Analysis in human salivary gland and pancreas tissues using NBP1-81424 antibody. Corresponding NDRG2 RNA-seq data are presented for the same tissues.

Western Blot: NDRG2 Antibody [NBP1-81424] - Analysis in human liver tissue.

Immunocytochemistry/Immunofluorescence: NDRG2 Antibody [NBP1-81424] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol and microtubule organizing center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil and glial cells.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-81424] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDRG2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDRG2 Antibody - BSA Free (NBP1-81424) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NDRG2 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDRG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26380811). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  NDRG2 Protein (NBP1-81424PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 26380811).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDRG2 Antibody - BSA Free

• DKFZp781G1938
• FLJ25522
• KIAA1248cytoplasmic protein Ndr1
• NDR1-related protein NDR2
• NDRG family member 2
• protein NDRG2
• Protein Syld709613
• syld709613 protein
• SYLDN-myc downstream regulator 2

Background

NDRG2 is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDRG2 Antibody (NBP1-81424)(5)

Publications using NBP1-81424

• Anderson KJ, Russell AP, Foletta VC. NDRG2 promotes myoblast proliferation and caspase 3/7 activities during differentiation, and attenuates hydrogen peroxide - But not palmitate-induced toxicity. FEBS Open Bio 2015-01-01 [PMID: 26380811] (WB, Mouse)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Schilling SH, Hjelmeland AB, Radiloff DR et al. NDRG4 Is Required for Cell Cycle Progression and Survival in Glioblastoma Cells. J Biol Chem 2009-09-11 [PMID: 19592488]
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]
• Tepel M, Roerig P, Wolter M et al. Frequent promoter hypermethylation and transcriptional downregulation of the NDRG2 gene at 14q11.2 in primary glioblastoma. Int J Cancer 2008-11-01 [PMID: 18709645]

Bioinformatics

• Gene Symbol: NDRG2
• Entrez:
  • 57447(Human)
• Uniprot:
  • Q9UN36(Human)