Home » NDRG4 » NDRG4 Antibodies » NDRG4 Antibody (2G3)

NDRG4 Antibody (2G3)

 (8 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: NDRG4 Antibody (2G3) [H00065009-M01] - Analysis of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. Antibody concentration 3 ug/ml.
Sandwich ELISA: NDRG4 Antibody (2G3) [H00065009-M01] - Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDRG4 Antibody (2G3) Summary

Immunogen
NDRG4 (AAH11795, 1 a.a. ~ 340 a.a) full length recombinant protein with GST tag.MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLN HKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGY QFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALI FPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSH LFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRD LDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVE
Localization
Cytoplasmic
Specificity
NDRG4 - NDRG family member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and Immunohistochemistry (Paraffin).Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 17008871)
Publications
Read Publications using
H00065009-M01 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    4 publications

Reactivity Notes

Human, Mouse.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG4 Antibody (2G3)

  • BDM1
  • Brain development-related molecule 1
  • DKFZp686I1615
  • FLJ30586
  • KIAA1180FLJ42011
  • NDRG family member 4
  • protein NDRG4
  • SMAP-8MGC19632
  • smooth muscle-associated protein 8
  • Vascular smooth muscle cell-associated protein 8

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDRG1 Antibody
NBP1-86636
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7 using Anti-NDRG1 antibody. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: NDRG1 Antibody [NBP1-86636] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(4 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
n-Myc Antibody
(NMYC-1)
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Western blot analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/ Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Western blot analysis of n-Myc expression in human heart tissue.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot: MEK1 Antibody (1F5) [NBP1-47833] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MEK1(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MEK1.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (1F5) [NBP1-47833] Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK1.
Immunohistochemistry-Paraffin: MEK1 Antibody (1F5) [NBP1-47833] - Staining of paraffin-embedded prostate tissue using anti-MEK1 mouse monoclonal antibody.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NDRG2 Antibody
(6A5)
H00057447-M03
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - Analysis of NDRG2 expression in Hela S3 NE.
Western Blot: NDRG2 Antibody (6A5) [H00057447-M03] - Analysis of NDRG2 expression in transfected 293T cell line by NDRG2 monoclonal antibody (M03), clone 6A5. Lane 1: NDRG2 transfected lysatE (39.7 KDa). Lane 2: Non-transfected lysate.
ELISA: NDRG2 Antibody (6A5) [H00057447-M03] - Detection limit for recombinant GST tagged NDRG2 is approximately 0.03ng/ml as a capture antibody.
(16 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA
BMP-3
113-BP/CF
BMP-3
(4 Publications)
Species: Hu
MEK2 Antibody
(SD207-08)
NBP2-67791
Western Blot: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of MEK2 on different lysates using anti-MEK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Jurkat Lane 2: Hela Lane 3: 293T
Immunocytochemistry/Immunofluorescence: MEK2 Antibody (SD207-08) [NBP2-67791] - Staining MEK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of paraffin-embedded mouse lung tissue using anti-MEK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NDRG3 Antibody
NBP1-86046
Western Blot: NDRG3 Antibody [NBP1-86046] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDRG3 Antibody [NBP1-86046] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: NDRG3 Antibody [NBP1-86046] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - analysis of HeLa cell culture stained with chicken pAb to vimentin, NB300-223, dilution 1:10,000 in green, and costained with EnCor mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates using chicken pAb to Vimentin, NB300-223, dilution 1:5,000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5,000 in green, revealing multiple bands around 280kDa that correspond to full length MAP2A/2B isotypes, and ~70kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Arg-Vasopressin
Antibody
NB100-65214
Arg-Vasopressin Antibody
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
PPOX Antibody
(2F10)
H00005498-M01
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10.Lane 1: PPOX transfected lysate(50.8 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: PPOX Antibody (2F10) [H00005498-M01] - Analysis of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ug/ml.
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX over-expressed 293 cell line, cotransfected with PPOX Validated Chimera RNAi ( Cat # H00005498-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPOX monoclonal antibody (M01), clone 2F10 (Cat # H00005498-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(3 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and p38 alpha (1 ng/lane). PVDF membrane was probed with 0.2 µg/mL Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for p38 gamma was detected at approx­imately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of PC-12 rat adrenal pheochromocytoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.2 µg/mL Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for p38 gamma was detected at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p38 gamma was detected in immersion fixed MCF‑7 human breast cancer cell line using Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Oxytocin Antibody
NBP1-52131
Immunohistochemistry: Oxytocin Antibody [NBP1-52131] - Staining of PFA-perfused cryosection of Human Hypothalamus. Antigen retrieval with citrate buffer pH 6 at 80C for 30min, HRP-staining with Ni-DAB after Biotin-SP-antigoat amplification. Data obtained by Prof. Erik Hrabovszky, Inst, Exp, Med., Budapest, Hungary.
(1 Publication)
Species: Hu
Applications: IHC, PEP-ELISA
c-Fos Antibody
NB110-75039
Western Blot: c-Fos Antibody [NB110-75039] - Analysis on marmoset brain lysate prepared in Ripa buffer containing 1% Triton-X100; 1% SDS and 1% SDC. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution 1:2000incubated at 4C overnight.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody [NB110-75039] - Rat trigeminal using Rabbit antibody to cFos: whole serum at a 1:500 dilution.
Immunohistochemistry-Paraffin: c-Fos Antibody [NB110-75039] - IHC on rat brain (paraffin section) using Rabbit antibody to cFos (c-fos): whole serum at 1: 300 dilution incubated overnight at 4C and developed with ABC/DAB/Ni.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
TFPI-2 Antibody
(243220)
MAB2545
TFPI-2 Antibody (243220)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - KRAS monoclonal antibody (M01), clone 3B10-2F2 Analysis of KRAS expression in HeLa.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(10 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Oxytocin Antibody
NBP1-52131
Immunohistochemistry: Oxytocin Antibody [NBP1-52131] - Staining of PFA-perfused cryosection of Human Hypothalamus. Antigen retrieval with citrate buffer pH 6 at 80C for 30min, HRP-staining with Ni-DAB after Biotin-SP-antigoat amplification. Data obtained by Prof. Erik Hrabovszky, Inst, Exp, Med., Budapest, Hungary.
(1 Publication)
Species: Hu
Applications: IHC, PEP-ELISA
NDRG4 Antibody
(2G3)
H00065009-M01
NDRG4 Antibody (2G3)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NDRG4 Antibody (H00065009-M01)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(4)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00065009-M01 Applications Species
Vaes N, Lentjes MHFM, Gijbels MJ et al. NDRG4, an early detection marker for colorectal cancer, is specifically expressed in enteric neurons. Neurogastroenterol Motil 2017 May 19 [PMID: 28524415]
Yang Q, Gu Y, Zhang X et al. Uterine Expression of NDRG4 Is Induced by Estrogen and Up-Regulated during Embryo Implantation Process in Mice. PLoS One 2016 May 13 [PMID: 27175791] (WB) WB
Qu X, Li J, Baldwin HS. Postnatal lethality and abnormal development of foregut and spleen in Ndrg4 mutant mice. Biochem. Biophys. Res. Commun. 2016 Jan 19 [PMID: 26801554] (WB, Mouse) WB Mouse
Chu D, Zhang Z, Zhou Y et al. NDRG4, a novel candidate tumor suppressor, is a predictor of overall survival of colorectal cancer patients. Oncotarget 2015 Apr 10 [PMID: 25749388] (WB) WB
Benesh EC, Miller PM, Pfaltzgraff ER et al. Bves and NDRG4 regulate directional epicardial cell migration through autocrine extracellular matrix deposition. Mol Biol Cell. 2013 Sep 18 [PMID: 24048452] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Ding W, Zhang J, Yoon JG et al. NDRG4 is downregulated in glioblastoma and inhibits cell proliferation. OMICS. 2012 May [PMID: 22489821] (WB, Human) WB Human
Melotte V, Lentjes MH, van den Bosch SM et al. N-Myc Downstream-Regulated Gene 4 (NDRG4): A Cidate Tumor Suppressor Gene Potential Biomarker for Colorectal Cancer. J Natl Cancer Inst 101(13):916-27. 2009 Jul 1. [PMID: 19535783]
Wang JF, Hill DJ. Identification action of N-myc downstream regulated gene 4 A2 in rat pancreas. J Endocrinol 201(1):15-25. 2009 Apr. [PMID: 19193716]

Reviews for NDRG4 Antibody (H00065009-M01) (0)

There are no reviews for NDRG4 Antibody (H00065009-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG4 Antibody (H00065009-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG4 Products

Bioinformatics Tool for NDRG4 Antibody (H00065009-M01)

Discover related pathways, diseases and genes to NDRG4 Antibody (H00065009-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG4 Antibody (H00065009-M01)

Discover more about diseases related to NDRG4 Antibody (H00065009-M01).
 

Pathways for NDRG4 Antibody (H00065009-M01)

View related products by pathway.

PTMs for NDRG4 Antibody (H00065009-M01)

Learn more about PTMs related to NDRG4 Antibody (H00065009-M01).
 

Research Areas for NDRG4 Antibody (H00065009-M01)

Find related products by research area.

Blogs on NDRG4

There are no specific blogs for NDRG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG4 Antibody (2G3) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDRG4
Entrez
Uniprot