NDRG4 Antibody (2G3)

Images

 
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: NDRG4 Antibody (2G3) [H00065009-M01] - Analysis of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. Antibody concentration 3 ug/ml.
Sandwich ELISA: NDRG4 Antibody (2G3) [H00065009-M01] - Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDRG4 Antibody (2G3) Summary

Immunogen
NDRG4 (AAH11795, 1 a.a. ~ 340 a.a) full length recombinant protein with GST tag.MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLN HKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGY QFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALI FPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSH LFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRD LDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVE
Localization
Cytoplasmic
Specificity
NDRG4 - NDRG family member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and Immunohistochemistry (Paraffin).Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 17008871)
Publications
Read Publications using
H00065009-M01 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    4 publications

Reactivity Notes

Human, Mouse.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG4 Antibody (2G3)

  • BDM1
  • Brain development-related molecule 1
  • DKFZp686I1615
  • FLJ30586
  • KIAA1180FLJ42011
  • NDRG family member 4
  • protein NDRG4
  • SMAP-8MGC19632
  • smooth muscle-associated protein 8
  • Vascular smooth muscle cell-associated protein 8

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00057447-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
113-BP/CF
Species: Hu
NBP1-47836
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-86046
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF2567
Species: Mu
Applications: WB, IHC
MAB2545
Species: Hu
Applications: WB, IHC, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
H00065009-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NDRG4 Antibody (H00065009-M01)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(4)
All Applications
Filter By Species
Human
(1)
Mouse
(2)
All Species

Reviews for NDRG4 Antibody (H00065009-M01) (0)

There are no reviews for NDRG4 Antibody (H00065009-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG4 Antibody (H00065009-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG4 Products

Bioinformatics Tool for NDRG4 Antibody (H00065009-M01)

Discover related pathways, diseases and genes to NDRG4 Antibody (H00065009-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG4 Antibody (H00065009-M01)

Discover more about diseases related to NDRG4 Antibody (H00065009-M01).
 

Pathways for NDRG4 Antibody (H00065009-M01)

View related products by pathway.

PTMs for NDRG4 Antibody (H00065009-M01)

Learn more about PTMs related to NDRG4 Antibody (H00065009-M01).
 

Research Areas for NDRG4 Antibody (H00065009-M01)

Find related products by research area.

Blogs on NDRG4

There are no specific blogs for NDRG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG4 Antibody (2G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG4
Entrez
Uniprot