Home » NDRG4 » NDRG4 Antibodies » NDRG4 Antibody (2G3)

NDRG4 Antibody (2G3)

 (9 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: NDRG4 Antibody (2G3) [H00065009-M01] - Analysis of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. Antibody concentration 3 ug/ml.
ELISA: NDRG4 Antibody (2G3) [H00065009-M01] - Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDRG4 Antibody (2G3) Summary

Immunogen
NDRG4 (AAH11795.1, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC
Localization
Cytoplasmic
Specificity
NDRG4 - NDRG family member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and Immunohistochemistry (Paraffin).Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 17008871)
Publications
Read Publications using
H00065009-M01 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    5 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG4 Antibody (2G3)

  • BDM1
  • Brain development-related molecule 1
  • DKFZp686I1615
  • FLJ30586
  • KIAA1180FLJ42011
  • NDRG family member 4
  • protein NDRG4
  • SMAP-8MGC19632
  • smooth muscle-associated protein 8
  • Vascular smooth muscle cell-associated protein 8

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDRG1 Antibody
NBP1-86636
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: NDRG1 Antibody [NBP1-86636] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human prostate shows strong membranous positivity in glandular cells.
(5 Publications)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
n-Myc Antibody
(NMYC-1)
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
(5 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
MEK1 Antibody
(SZ22-01)
NBP2-67358
Western Blot: MEK1 Antibody (SZ22-01) [NBP2-67358] - Whole cell lysates (30 ug per lane) from three different hematological cancer cell lines. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of paraffin-embedded mouse uterus tissue using anti-MEK1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NDRG2 Antibody
(6A5)
H00057447-M03
Knockdown Validated: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 downregulates GLUT1 by promoting its ubiquitination. ((B), (D) and (F) T-47D cells were transfected with NDRG2 small interfering RNA (siRNA) 10, 25 and 100 pmol or control siRNA for 48 hours. Next, cell proteins or mRNA were extracted and analysed by immunoblotting (B). beta-actin was used as a loading control. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. SK-BR-3 cells were fixed and incubated with primary antibodies against N-myc downstream-regulated gene 2 (NDRG2) or glucose transporter 1 (GLUT1) and with fluorescein isothiocyanate or a cyanine 3 secondary antibody. Green fluorescence indicates NDRG2 expression, red fluorescence indicates GLUT1 expression and blue fluorescence indicates nuclear staining. The results of the merged images reveal that NDRG2 and GLUT1 were colocalised in the cytoplasm. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival and negatively correlated with GLUT1 in breast carcinoma. Kaplan-Meier analysis was carried out according to N-myc downstream-regulated gene 2 (NDRG2) expression levels of disease-free survival. Serial immunostained sections for NDRG2 and glucose transporter 1 (GLUT1) in breast cancer and normal tissues were analysed. Original magnification, 40x (top) and 400x (bottom); scale bars = 50 um. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
(18 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
Human BMP-3 ELISA
Kit (Colorimetric)
NBP2-69993
Human BMP-3 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Hu
MEK2 Antibody
(SD207-08)
NBP2-67791
Western Blot: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of MEK2 on different lysates using anti-MEK2 antibody at 1/1,000 dilution. Positive control: Lane 1: Jurkat Lane 2: Hela Lane 3: 293T
Immunocytochemistry/Immunofluorescence: MEK2 Antibody (SD207-08) [NBP2-67791] - Staining MEK2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MEK2 Antibody (SD207-08) [NBP2-67791] - Analysis of paraffin-embedded mouse lung tissue using anti-MEK2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NDRG3 Antibody
NBP1-86046
Western Blot: NDRG3 Antibody [NBP1-86046] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: NDRG3 Antibody [NBP1-86046] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Vimentin Antibody
NB300-223
Western Blot: Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates. Antibody at 1:5000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5000 in green, revealing multiple bands around 280 kDa that correspond to full length MAP2A/2B isotypes, and ~70 kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Comparative analysis of epithelial and mesenchymal markers expressions. Fluorescence immunocytochemistry staining for E-cadherin (green), N-cadherin (red) and vimentin (cyan) was performed on esophageal cancer cells under static and microfluidic flow conditions at different time points. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep38221), licensed under a CC-BY licence.
Immunohistochemistry: Vimentin Antibody [NB300-223] - Increased numbers of differentiating NSPCs in SVZ of G93A-SOD1 brain. Confocal microscopy images of dorsal and ventral regions of SVZ in G93A-SOD1 and Wt-SOD1 brain at postnatal week 18, stained for nestin (green), GFAP (red), and vimentin (blue). Scale bar = 50 um. Image collected and cropped by CiteAb from the following publication (http://www.molecularbrain.com/content/8/1/5), licensed under a CC-BY licence.
(6 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Human Copeptin
ELISA Kit (Colorimetr
NBP2-69822
Human Copeptin ELISA Kit (Colorimetric) - Standard Curve Reference
(1 Publication)
Species: Hu
PPOX Antibody
(2F10)
H00005498-M01
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10.Lane 1: PPOX transfected lysate(50.8 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: PPOX Antibody (2F10) [H00005498-M01] - Analysis of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ug/ml.
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX over-expressed 293 cell line, cotransfected with PPOX Validated Chimera RNAi ( Cat # H00005498-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPOX monoclonal antibody (M01), clone 2F10 (Cat # H00005498-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, RNAi
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Western blot shows recombinant human p38 beta, p38 gamma, p38δ and p38 alpha (1 ng/lane). PVDF membrane was probed with 0.2 µg/mL Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for p38 gamma was detected at approx­imately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of PC-12 rat adrenal pheochromocytoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.2 µg/mL Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for p38 gamma was detected at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p38 gamma was detected in immersion fixed MCF‑7 human breast cancer cell line using Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC

Oxytocin/Neurophysin I
NBP1-52131
Immunohistochemistry-Frozen: Oxytocin/Neurophysin I Antibody [NBP1-52131] - PFA-perfused cryosection of human hypothalamus. Oxytocin/Neurophysin I antibody at 0.05 ug/mL. Antigen retrieval with citrate buffer pH 6 at 80C for 30min, HRP-staining with Ni-DAB after Biotin-SP-anti-goat amplification. Data obtained by Prof. Erik Hrabovszky, Inst, Exp, Med., Budapest, Hungary.
(1 Publication)
Species: Hu
Applications: IHC, IHC-Fr, PEP-ELISA
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
TFPI-2 Antibody
AF2545
TFPI-2 Antibody
(2 Publications)
Species: Hu
Applications: WB, IP, Neut
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: KRAS Antibody (3B10-2F2) [H00003845-M01] - Analysis of monoclonal antibody to KRAS on HeLa cell. Antibody concentration 10 ug/ml.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
Oxytocin ELISA Kit
(Colorimetric)
NBP2-80261
ELISA: Universal Oxytocin ELISA Kit (Colorimetric) [NBP2-80261] - Standard Reference Curve

Publications for NDRG4 Antibody (H00065009-M01)(9)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(5)
All Applications
Filter By Species
Human
(2)
Mouse
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00065009-M01 Applications Species
Zhang Z, She J, Yang J et al. NDRG4 in gastric cancer determines tumor cell proliferation and clinical outcome. Mol Carcinog 2018 Jun [PMID: 29500881] (WB, Human) WB Human
Vaes N, Lentjes MHFM, Gijbels MJ et al. NDRG4, an early detection marker for colorectal cancer, is specifically expressed in enteric neurons. Neurogastroenterol Motil 2017 May 19 [PMID: 28524415]
Yang Q, Gu Y, Zhang X et al. Uterine Expression of NDRG4 Is Induced by Estrogen and Up-Regulated during Embryo Implantation Process in Mice. PLoS One 2016 May 13 [PMID: 27175791] (WB) WB
Qu X, Li J, Baldwin HS. Postnatal lethality and abnormal development of foregut and spleen in Ndrg4 mutant mice. Biochem. Biophys. Res. Commun. 2016 Jan 19 [PMID: 26801554] (WB, Mouse) WB Mouse
Chu D, Zhang Z, Zhou Y et al. NDRG4, a novel candidate tumor suppressor, is a predictor of overall survival of colorectal cancer patients. Oncotarget 2015 Apr 10 [PMID: 25749388] (WB) WB
Benesh EC, Miller PM, Pfaltzgraff ER et al. Bves and NDRG4 regulate directional epicardial cell migration through autocrine extracellular matrix deposition. Mol Biol Cell. 2013 Sep 18 [PMID: 24048452] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Ding W, Zhang J, Yoon JG et al. NDRG4 is downregulated in glioblastoma and inhibits cell proliferation. OMICS. 2012 May [PMID: 22489821] (WB, Human) WB Human
Melotte V, Lentjes MH, van den Bosch SM et al. N-Myc Downstream-Regulated Gene 4 (NDRG4): A Cidate Tumor Suppressor Gene Potential Biomarker for Colorectal Cancer. J Natl Cancer Inst 101(13):916-27. 2009 Jul 1. [PMID: 19535783]
Wang JF, Hill DJ. Identification action of N-myc downstream regulated gene 4 A2 in rat pancreas. J Endocrinol 201(1):15-25. 2009 Apr. [PMID: 19193716]

Reviews for NDRG4 Antibody (H00065009-M01) (0)

There are no reviews for NDRG4 Antibody (H00065009-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG4 Antibody (H00065009-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional NDRG4 Products

Bioinformatics Tool for NDRG4 Antibody (H00065009-M01)

Discover related pathways, diseases and genes to NDRG4 Antibody (H00065009-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG4 Antibody (H00065009-M01)

Discover more about diseases related to NDRG4 Antibody (H00065009-M01).
 

Pathways for NDRG4 Antibody (H00065009-M01)

View related products by pathway.

PTMs for NDRG4 Antibody (H00065009-M01)

Learn more about PTMs related to NDRG4 Antibody (H00065009-M01).
 

Research Areas for NDRG4 Antibody (H00065009-M01)

Find related products by research area.

Blogs on NDRG4

There are no specific blogs for NDRG4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG4 Antibody (2G3) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDRG4
Entrez
Uniprot