Home » NDRG4 » NDRG4 Antibodies » NDRG4 Antibody (2G3)

NDRG4 Antibody (2G3)

 (9 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Western Blot: NDRG4 Antibody (2G3) [H00065009-M01] - NDRG4 monoclonal antibody (M01), clone 2G3. Analysis of NDRG4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: NDRG4 Antibody (2G3) [H00065009-M01] - Analysis of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. Antibody concentration 3 ug/ml.
ELISA: NDRG4 Antibody (2G3) [H00065009-M01] - Detection limit for recombinant GST tagged NDRG4 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NDRG4 Antibody (2G3) Summary

Immunogen
NDRG4 (AAH11795.1, 1 a.a. ~ 339 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC
Localization
Cytoplasmic
Specificity
NDRG4 - NDRG family member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and Immunohistochemistry (Paraffin).Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 17008871)
Publications
Read Publications using
H00065009-M01 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    5 publications

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG4 Antibody (2G3)

  • BDM1
  • Brain development-related molecule 1
  • DKFZp686I1615
  • FLJ30586
  • KIAA1180FLJ42011
  • NDRG family member 4
  • protein NDRG4
  • SMAP-8MGC19632
  • smooth muscle-associated protein 8
  • Vascular smooth muscle cell-associated protein 8

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDRG1 Antibody
NBP1-86636
Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.
(5 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
n-Myc Antibody
(NMYC-1) - BSA Free
NB200-109
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in human heart tissue.
Western Blot: n-Myc Antibody (NMYC-1) [NB200-109] - Analysis of n-Myc expression in IMR32 whole cell lysate.
Immunocytochemistry/Immunofluorescence: n-Myc Antibody (NMYC-1) [NB200-109] - The n-Myc (NMYC-1) antibody was tested in NTERA2 cells at a 1:50 dilution against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.
(6 Publications)
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
MEK1 Antibody
(SZ22-01)
NBP2-67358
Flow Cytometry: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of HeLa cells with MEK1 antibody at 1:50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in HeLa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
(1 Review)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NDRG2 Antibody
(6A5)
H00057447-M03
Immunocytochemistry/Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 interacts with GLUT1. SK-BR-3 cells were fixed and incubated with primary antibodies against N-myc downstream-regulated gene 2 (NDRG2) or glucose transporter 1 (GLUT1) and with fluorescein isothiocyanate or a cyanine 3 secondary antibody. Green fluorescence indicates NDRG2 expression, red fluorescence indicates GLUT1 expression and blue fluorescence indicates nuclear staining. The results of the merged images reveal that NDRG2 and GLUT1 were colocalised in the cytoplasm. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 decreases the glucose uptake and GLUT1 protein levels in SK-BR-3-based subcutaneously xenograft tumours. The experiments illustrated are described in the Methods section. Intratumoural protein expression was assessed by N-myc downstream-regulated gene 2 (NDRG2) and glucose transporter 1 (GLUT1) IHC staining. Representative images are shown. Original magnification: 400 x; Scale bars = 50 um. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
Immunohistochemistry: NDRG2 Antibody (6A5) [H00057447-M03] - NDRG2 is correlated with increased survival and negatively correlated with GLUT1 in breast carcinoma. Kaplan-Meier analysis was carried out according to N-myc downstream-regulated gene 2 (NDRG2) expression levels of disease-free survival. Serial immunostained sections for NDRG2 and glucose transporter 1 (GLUT1) in breast cancer and normal tissues were analysed. Original magnification, 40x (top) and 400x (bottom); scale bars = 50 um. Image collected and cropped by CiteAb from the following publication (http://breast-cancer-research.biomedcentral.com/articles/10.1186/bcr3628) licensed under a CC-BY licence.
(18 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
BMP-3
113-BP/CF
BMP-3
(4 Publications)
Species: Hu
Applications: BA
MEK2 Antibody
(SR13-07)
NBP2-67332
Immunocytochemistry/Immunofluorescence: MEK2 Antibody (SR13-07) [NBP2-67332] - Staining MEK1/2 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: MEK2 Antibody (SR13-07) [NBP2-67332] - Staining MEK1/2 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: MEK2 Antibody (SR13-07) [NBP2-67332] - Analysis of paraffin-embedded human kidney tissue using anti-MEK1/2 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
NDRG3 Antibody
NBP1-86046
Western Blot: NDRG3 Antibody [NBP1-86046] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: NDRG3 Antibody [NBP1-86046] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(54 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
PPOX Antibody
(2F10)
H00005498-M01
Western Blot: PPOX Antibody (2F10) [H00005498-M01] - Analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10.Lane 1: PPOX transfected lysate(50.8 KDa).Lane 2: Non-transfected lysate.
ELISA: PPOX Antibody (2F10) [H00005498-M01] - Detection limit for recombinant GST tagged PPOX is approximately 0.1ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: PPOX Antibody (2F10) [H00005498-M01] - Analysis of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 3 ug/ml.
(3 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
p38 gamma was detected in immersion fixed MCF‑7 human breast cancer cell line using Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of C2C12 mouse myoblast cell line and PC‑12 rat adrenal pheochromocytoma cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 gamma at approximately 48 kDa (as indicated) using 2 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of PC-12 rat adrenal pheochromocytoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.2 µg/mL Rabbit Anti-Human/Mouse/Rat p38 gamma Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1347) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for p38 gamma was detected at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB

Oxytocin/Neurophysin I
NBP2-68928
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Species: Hu
Applications: IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
ASCL1/Mash1
Antibody [Unconjugate
AF2567
ASCL1/Mash1 was detected in immersion fixed paraffin-embedded sections of mouse embryo (13 d.p.c., cross-section through developing CNS) using Goat Anti-Mouse ASCL1/Mash1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2567) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
(2 Publications)
Species: Mu
Applications: IHC, WB
TFPI-2 Antibody
AF2545
TFPI-2 Antibody
(2 Publications)
Species: Hu
Applications: IP, Neut, WB
KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - miRNA-768-3p specifically targets K-ras. Effect of miRNA inhibitors that were reduced by co-culture on the level of pan-RAS, phospho-B-Raf and CD44 and pan-Akt by western blotting. Also shown is the effect of different miRNA inhibitors on the level of K-ras in H520 cells by western blot. Cropped blots are shown and were run under the same experimental conditions. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep02392), licensed under a CC-BY licence.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western Blot analysis of KRAS expression in transfected 293T cell line by KRAS monoclonal antibody (M01), clone 3B10-2F2.Lane 1: KRAS transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Western Blot: KRAS Antibody (3B10-2F2) [H00003845-M01] - Western blot analysis of KRAS expression in lysates from human lung cancer cell lines: H23, H358, A549, and H441. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Oxytocin ELISA Kit
(Colorimetric)
NBP2-80261
ELISA: Universal Oxytocin ELISA Kit (Colorimetric) [NBP2-80261] - Standard Reference Curve
Applications: ELISA

Publications for NDRG4 Antibody (H00065009-M01)(9)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(5)
All Applications
Filter By Species
Human
(2)
Mouse
(2)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00065009-M01 Applications Species
Zhang Z, She J, Yang J et al. NDRG4 in gastric cancer determines tumor cell proliferation and clinical outcome. Mol Carcinog 2018 Jun [PMID: 29500881] (WB, Human) WB Human
Vaes N, Lentjes MHFM, Gijbels MJ et al. NDRG4, an early detection marker for colorectal cancer, is specifically expressed in enteric neurons. Neurogastroenterol Motil 2017 May 19 [PMID: 28524415]
Yang Q, Gu Y, Zhang X et al. Uterine Expression of NDRG4 Is Induced by Estrogen and Up-Regulated during Embryo Implantation Process in Mice. PLoS One 2016 May 13 [PMID: 27175791] (WB) WB
Qu X, Li J, Baldwin HS. Postnatal lethality and abnormal development of foregut and spleen in Ndrg4 mutant mice. Biochem. Biophys. Res. Commun. 2016 Jan 19 [PMID: 26801554] (WB, Mouse) WB Mouse
Chu D, Zhang Z, Zhou Y et al. NDRG4, a novel candidate tumor suppressor, is a predictor of overall survival of colorectal cancer patients. Oncotarget 2015 Apr 10 [PMID: 25749388] (WB) WB
Benesh EC, Miller PM, Pfaltzgraff ER et al. Bves and NDRG4 regulate directional epicardial cell migration through autocrine extracellular matrix deposition. Mol Biol Cell. 2013 Sep 18 [PMID: 24048452] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Ding W, Zhang J, Yoon JG et al. NDRG4 is downregulated in glioblastoma and inhibits cell proliferation. OMICS. 2012 May [PMID: 22489821] (WB, Human) WB Human
Melotte V, Lentjes MH, van den Bosch SM et al. N-Myc Downstream-Regulated Gene 4 (NDRG4): A Cidate Tumor Suppressor Gene Potential Biomarker for Colorectal Cancer. J Natl Cancer Inst 101(13):916-27. 2009 Jul 1. [PMID: 19535783]
Wang JF, Hill DJ. Identification action of N-myc downstream regulated gene 4 A2 in rat pancreas. J Endocrinol 201(1):15-25. 2009 Apr. [PMID: 19193716]

Reviews for NDRG4 Antibody (H00065009-M01) (0)

There are no reviews for NDRG4 Antibody (H00065009-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG4 Antibody (H00065009-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG4 Products

Bioinformatics Tool for NDRG4 Antibody (H00065009-M01)

Discover related pathways, diseases and genes to NDRG4 Antibody (H00065009-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG4 Antibody (H00065009-M01)

Discover more about diseases related to NDRG4 Antibody (H00065009-M01).
 

Pathways for NDRG4 Antibody (H00065009-M01)

View related products by pathway.

PTMs for NDRG4 Antibody (H00065009-M01)

Learn more about PTMs related to NDRG4 Antibody (H00065009-M01).
 

Research Areas for NDRG4 Antibody (H00065009-M01)

Find related products by research area.

Blogs on NDRG4

There are no specific blogs for NDRG4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG4 Antibody (2G3) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDRG4
Entrez
Uniprot