NDRG3 Antibody

Images

 
Immunohistochemistry-Paraffin: NDRG3 Antibody [NBP1-86054] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells and in cells of granular layer.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDRG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVIL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDRG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDRG3 Protein (NBP1-86054PEP)
Publications
Read Publication using NBP1-86054.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDRG3 Antibody

  • FLJ13556
  • NDRG family member 3
  • N-myc downstream-regulated gene 3
  • protein NDRG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00057447-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00065009-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45983
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-82591
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
H00001646-M03
Species: Hu
Applications: WB, ELISA
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-98528
Species: Hu
Applications: WB
NBP1-69668
Species: Hu
Applications: WB
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for NDRG3 Antibody (NBP1-86054)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NDRG3 Antibody (NBP1-86054) (0)

There are no reviews for NDRG3 Antibody (NBP1-86054). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDRG3 Antibody (NBP1-86054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG3