N-Cadherin Antibody (CL3716)

Knockdown Validated: N-Cadherin Antibody (CL3716) [NBP2-61632] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining in human heart muscle and skin tissues. Corresponding CDH2 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of U-251 cells using the Anti-CDH2 monoclonal antibody, showing specific staining in the plasma membrane and cell junctions in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).

Western Blot: N-Cadherin Antibody (CL3716) [NBP2-61632] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-251 MG

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of human heart muscle shows strong positivity in the intercalated discs of cardiomyocytes.

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of human liver cancer (hepatocellular carcinoma) shows moderate to strong membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: N-Cadherin Antibody (CL3716) [NBP2-61632] - Staining of human skin shows no positivity in epidermal cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clone: CL3716
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

N-Cadherin Antibody (CL3716) Summary

• Immunogen: This N-Cadherin Antibody (CL3716) was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP.
• Epitope: ENPYFAPNPK
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG1
• Clonality: Monoclonal
• Host: Mouse
• Gene: CDH2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 1 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  N-Cadherin Recombinant Protein Antigen (NBP2-61632PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for N-Cadherin Antibody (CL3716)

• ACOGS
• ARVD14
• cadherin 2, type 1, N-cadherin (neuronal)
• Cadherin-2
• calcium-dependent adhesion protein, neuronal
• CD325 antigen
• CD325
• CDH2
• CDHN
• CDw325
• NCAD
• N-cadherin 1
• NCadherin
• N-Cadherin
• Neural cadherin
• neural-cadherin

Background

N-Cadherin, also referred to as Neural Cadherin (NCAD) or Cadherin-2 (CHD2), is a 130 kDa protein that is a member of the calcium-dependent adhesion molecule family of classical (type I) cadherins (1-4). Under the CDH2 gene, human N-cadherin is synthesized as a 906 amino acid protein with a theoretical molecular weight of 99.8 kDa (5). The N-cadherin protein structure is similar to other classical type I cadherins including epithelial (E-) cadherin and placental (P-) cadherin (1,2). N-cadherin consists of a 25 amino acid (aa) N-terminal signal peptide and 134 aa pro-peptide, a 565 aa extracellular domain (ECD) with five cadherin repeats, a 21 aa transmembrane segment, and a 161 aa cytoplasmic domain (1-3,5). The ECD of N-cadherin monomers is responsible for homotypic binding through either cis or trans adhesion (2,3).

N-cadherin is expressed on multiple cell types but is most highly expressed by mesenchymal cells and neural tissue (2). Functionally, N-cadherin has a number of roles including maintaining structural integrity and adhesion, cell signaling, and formation of neuronal synapses and the vascular wall (2). The cytoplasmic tail interacts with beta-catenin which then binds with alpha-catenin, forming the cadherin-catenin adhesion complex, an important component of adhesions junctions (1-3). Given its role in adhesion, N-cadherin serves as an indicator of epithelial-to-mesenchymal transition (EMT) (1-4). The loss of E-cadherin during EMT corresponds with an increase in N-cadherin expression (1-4). This "cadherin-switch" is associated with increased migratory and invasive behavior observed in tumor progress (1-4). Proteases including activity of a disintegrin and metalloprotease 10 (ADAM10), matrix metalloproteinases (MMPs), caspase 3, presenilin, and calpain can cleave N-cadherin as a mechanism for regulating Wnt/beta-catenin signaling and inducing oncogenic signals (3,4). In addition to its expression in solid tumors, N-cadherin has been indicated in hematological disorders such as leukemia and multiple myeloma (1). N-cadherin antagonists are currently being studied as potential therapeutics for a variety of cancer studies (1-2).

References

1. Mrozik, K. M., Blaschuk, O. W., Cheong, C. M., Zannettino, A., & Vandyke, K. (2018). N-cadherin in cancer metastasis, its emerging role in haematological malignancies and potential as a therapeutic target in cancer. BMC Cancer. https://doi.org/10.1186/s12885-018-4845-0

2. Loh, C. Y., Chai, J. Y., Tang, T. F., Wong, W. F., Sethi, G., Shanmugam, M. K., Chong, P. P., & Looi, C. Y. (2019). The E-Cadherin and N-Cadherin Switch in Epithelial-to-Mesenchymal Transition: Signaling, Therapeutic Implications, and Challenges. Cells. https://doi.org/10.3390/cells8101118

3. Derycke, L. D., & Bracke, M. E. (2004). N-cadherin in the spotlight of cell-cell adhesion, differentiation, embryogenesis, invasion and signalling. The International Journal of Developmental Biology. https://doi.org/10.1387/ijdb.041793ld

4. Yu, W., Yang, L., Li, T., & Zhang, Y. (2019). Cadherin Signaling in Cancer: Its Functions and Role as a Therapeutic Target. Frontiers in Oncology. https://doi.org/10.3389/fonc.2019.00989

5. Unitprot (P1903)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDH2